SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000284073 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000284073
Domain Number 1 Region: 99-183
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000541
Family Canonical RBD 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000284073
Sequence length 462
Comment MSI2 (Homo_sapiens) musashi homolog 2 (Drosophila)
Sequence
MFIVVGSYMASKVPVASIPAAITESCSCSSLTISNIRGACCVQGAVLATSNSCCVILSPL
STNLIMFTMDAGGNAGCEAMEGTWKALTSALWQLHSADGFGFVTFENEDVVEKVCEIHFH
EINNKMVECKKAQPKEVMFPPGTRGRARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGF
APSYGYQFPATEPSGQPEELAHVWCCVCQLQGWHRCQEGGPFLSWLGLGFDSEGAIVSPT
SRAMRNCSRLSASVDCSGTLAGLAMTLELFEFATPGAEDCGSGEGLLELEVTPFSAVVDQ
SRDPWPQVLTIISWCSASQQRLMDQWRRQQWQQLEDQLSSRRKCKPEIPETYYPGRFYRV
LLKTHPGNSQLSVLLESEAVLNSYSAQPNFGAPASPAGSNPARPGGFPGANSPGPVADLY
GPASQDSGVGNYISAASPQPGSGFGHGIAGPLIATAFTNGYH
Download sequence
Identical sequences G5C427
HGL_H00000284073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]