SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000284154 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000284154
Domain Number 1 Region: 29-140
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-32
Family SH2 domain 0.0000269
Further Details:      
 
Domain Number 2 Region: 154-215
Classification Level Classification E-value
Superfamily SH3-domain 5.64e-23
Family SH3-domain 0.00036
Further Details:      
 
Domain Number 3 Region: 4-41
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000372
Family SH3-domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000284154
Sequence length 217
Comment GRAP (Homo_sapiens) GRB2-related adaptor protein
Sequence
MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGAEGFVPKNYIRVKPHPW
YSGRISRQLAEEILMKRNHLGAFLIRESESSPGEFSVSVNYGNQVQHFKVLREASGKYFL
WDEKFNSLNELVDFYRTTTIAKRRQVFLCDEEPLLQSPRACFAQAQFDFSAQDPSQLSFR
RGDIIEVLERPDPHWWRGRSCGRVGFFPRSYVQPVHL
Download sequence
Identical sequences G5BKM6
XP_004868817.1.39548 HGL_H00000284154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]