SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000284273 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000284273
Domain Number 1 Region: 331-344,375-581
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 3.23e-36
Family Cofactor-dependent phosphoglycerate mutase 0.024
Further Details:      
 
Domain Number 2 Region: 203-267
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000548
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 3 Region: 2-34
Classification Level Classification E-value
Superfamily UBA-like 0.00000312
Family UBA domain 0.0051
Further Details:      
 
Weak hits

Sequence:  HGL_H00000284273
Domain Number - Region: 39-166
Classification Level Classification E-value
Superfamily LigT-like 0.000188
Family Atu0111-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000284273
Sequence length 595
Comment UBASH3B (Homo_sapiens) ubiquitin associated and SH3 domain containing B
Sequence
QKALASTGGRSVQAACDWLFSHVGDPFLDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQI
CGKNKAHNIFPHITLCQFFMCEDSKVDALGEALQTTVSRWKCKFSAPLPLELYTSSNFIG
LFVKEDSAEVLKKFAADFAAEAASKTEVHVEPHKKQLHVTLAYHFQASHLPTLEKLAQNI
DVKLGCDWVATIFSRDIRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPMEQTSTSEG
WIYGTSLTTGCSGLLPENYITKADECSTWIFHGSYSILNTASSHSLTFGDGVLERRQYED
QGLGETMPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRY
IRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESKTIIDHVYCSPSLRC
VQTAHNILKGLQQENHLKIRVEPGLFEWTKWVAGNTLPAWIPPSELAAANLSVDTTYRPH
IPVSKLVVSESYDTYISRSFQVTKEIIGECKSKGNNILIVAHASSLEACTCQLQGLSPQN
SKDFVQMVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE
Download sequence
Identical sequences G5BRZ8
HGL_H00000284273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]