SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000284384 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000284384
Domain Number 1 Region: 254-529
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.57e-77
Family Protein kinases, catalytic subunit 0.0000000476
Further Details:      
 
Domain Number 2 Region: 76-203
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.11e-37
Family Synaptotagmin-like (S variant) 0.000000996
Further Details:      
 
Domain Number 3 Region: 17-73
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.94e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000284384
Sequence length 570
Comment PRKCA (Homo_sapiens) protein kinase C, alpha
Sequence
MLLWCCPELVVFTQQDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHK
QCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLI
PDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSF
GVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVELRQKFEKAKLGPAGNKVISPS
EDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDV
ECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAV
DLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWW
AYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLG
CGPEGERDVREHAFFRRIDWEKLESREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQ
LVIANIDQSDFEGFSYVNPQFVHPILQSAV
Download sequence
Identical sequences G5BIH8
HGL_H00000284384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]