SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000284629-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000284629-1
Domain Number 1 Region: 52-234
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.08e-47
Family Ankyrin repeat 0.00025
Further Details:      
 
Domain Number 2 Region: 275-334
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000766
Family SAM (sterile alpha motif) domain 0.021
Further Details:      
 
Weak hits

Sequence:  HGL_H00000284629-1
Domain Number - Region: 247-300,385-410
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000994
Family Pseudo ankyrin repeat 0.039
Further Details:      
 
Domain Number - Region: 337-434
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0214
Family Hemolysin E (HlyE, ClyA, SheA) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000284629-1
Sequence length 475
Comment ASZ1 (Homo_sapiens) ankyrin repeat, SAM and basic leucine zipper domain containing 1
Sequence
MAAGLLRGLPVAGGGESSDSEDDGWEIGYLDKACQKLKRPFPTEEKSEMFKKALTTGDIS
LVEELLDSGIDIESIFCYGWTPLMYAASVANIELVRVLLDRGANASFNKDKQTILITACS
ARGSEEQILKCVDLLLSRNADPNVACRRLMTPIMYAARDGHPQVVALLVVHGADINAQDE
NGYTALTWAARQGHKNVVLKLLELGANKMLQTKDGKTPSEIAKRNKHLEIFSFLSLTLNP
LEGKLPQLTKEETICKLLTADSDKEKDHIFGSYTAFGDLEIFLHGLGLEHMTDLLKEKDI
TLRHLLTMKKDEFTENGISSKDQQKIIAALKELEVGEINYADLPDVAKLEISGDEFLNFL
LKLNKQCGHLITAVQNIITELPVNSHKIVLEWASPRNFTSVCEELVSNVEALGEEVCKLK
DLIQKLQNERKNDPTHIPLMEEISTWKSRILKSTAITVCGFGLLLFVCKMTFQRK
Download sequence
Identical sequences G5B3Q9
HGL_H00000284629-1 XP_004865313.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]