SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000284629-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000284629-2
Domain Number 1 Region: 5-186
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.07e-46
Family Ankyrin repeat 0.00028
Further Details:      
 
Domain Number 2 Region: 227-286
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000149
Family SAM (sterile alpha motif) domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000284629-2
Sequence length 320
Comment ASZ1 (Homo_sapiens) ankyrin repeat, SAM and basic leucine zipper domain containing 1
Sequence
MFKEALTTGDTSLVEELLDSGIDIESIFCYGWTPLTYAASVANIELVRVLLDRGANASFN
KDKQTILITACSAHGSEGQILKCVDLLLSRNADPNVACRRLMTPIMYAARDGHPQVVALL
VVHGADINAQDENGYTALTWAAHQGHKNVVLKLLELGANKMLQTKDGKTPSEVAKRNKHL
EIFNFLSLTLNPLEGKLPQLTKEETICKLLRADSDKEKDHIFGSYTAFGDLEIFLHRLGL
EHMTDLLKEKDITLRHFLTMKKDEFTENGISSKDQQKIIAALKELEVGEINYAELPEVAK
LEISGDEFLNFLLKLNSVAI
Download sequence
Identical sequences G5BLK9
HGL_H00000284629-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]