SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000285599 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000285599
Domain Number 1 Region: 432-1004
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.04e-129
Family alpha-mannosidase, C-terminal domain 0.0000282
Further Details:      
 
Domain Number 2 Region: 23-350
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 8.58e-103
Family alpha-mannosidase 0.00000847
Further Details:      
 
Domain Number 3 Region: 354-455
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 1.14e-26
Family alpha-mannosidase, domain 2 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000285599
Sequence length 1007
Comment MAN2B2 (Homo_sapiens) mannosidase, alpha, class 2B, member 2
Sequence
MGLLRWLPLLLGPLLLRGSRAAGPIRAFVVPHSHMDVGWVYTVQESMRAYAANVYTTVVK
ELALGQQRRFIVVEQEFFRLWWDRVASEQQKQQVRRLLDQGRLEFVLGGQVMHDEAVTHL
DDQILQLTEGHGFLYETFGVRPRFSWHVDPFGASATTPTLFALAGFDAHLTSRVDYDLKD
AMQEAQGLQFVWRGSPSLAAQREIFTHVMDQFSYCTPSHVPFSNRSGFYWNGVAVFPEPP
PDGVYPNMSEPVTPANIDLYAQALVANVKQRATWFRTPHVLWPWGCDKQFFNASVQFANM
DPLLDHINSHAAQLGVMVEYATLGDYFRALHEFNATWGVRDHHDFLPYASEQLQAWTGFY
TSRSALKGLARQTSALLYAGESMFTRYMWPAPRGTLDPAWALQQLQQLRWAVSEVQHHDA
ITGTESPKVNDMYVQHLAVGSLGVHKLMASIAEDRAQHAALRSSSGTRPAGHLASVYNPL
AWTVTTIVSLTVSFPGVSVTDELGHAVPAQVQNSTKVPSAYDLLILVTIPGLSYRHYSIR
PTTGTQAAAAEASTVRFGRRLRHASREHRRLVPVANDCYTVLLDPDTNLLHSVQERQSNR
TVHMAQEFLEYHANGDTKQGPISDNYLFSPSKVAVPAWEAVELEIVAGKLVTEIRQHFYR
DAMAQAYTYAIHSRLAHVYQGGGAELLCYRVEQEYRVGPLELNREAILRTSSDLDSRQVL
YSDNNGYQMQRRPYREYVNNTIARNYYPMVQSAFIEDSRSRLVLLSERAHGISSQGGGQV
EVMLHRRLWNNLAWDLNYNLTLNDTSIVHPVLWLLLGPRAITAALRPQSALALQHRPVVL
LRELAREGSPAWGPAPKPPTTWQQAAVTLPPNLHLQILSIPGWNYSSSHQEHMQGLRTGH
RGRAQADLRRVLLRLHHLYEAGEDPVLSQPATVSLEAVLRGLGSVEAVEERSLTGTWDVH
AMERWSWRTDPGPRTGRPTSPSRPPGGSTITVYPKEIRTFFIHFRQH
Download sequence
Identical sequences G5B322
HGL_H00000285599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]