SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000285814-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000285814-2
Domain Number 1 Region: 6-77
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000012
Family Canonical RBD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000285814-2
Sequence length 241
Comment MKI67IP (Homo_sapiens) MKI67 (FHA domain) interacting nucleolar phosphoprotein
Sequence
MPGVTFVGRLPPVLFESQIKEYFSQFDYITRFRQSRSKRTGNSRGSAFVEFAFEAVAKMV
AERKGWQVPLHHPVYPAVKRYNHKRTLPQKLRMEDRFKKKEKLLRKKLIAKGIDDNFSSL
VLSTKKKEVSGKKGISTKKNKASDIPKKKKRVSEGSTVTPDKTVDSQSATPACAPTLLEK
RKSEVAEMKGDKDDEIVFKQPVSSVKDTPETPTPTRSGKKKTKAKKKQTVILNVLCAAYL
T
Download sequence
Identical sequences G5AS30
HGL_H00000285814-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]