SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000286349 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000286349
Domain Number 1 Region: 129-191
Classification Level Classification E-value
Superfamily RING/U-box 0.000000103
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 2 Region: 309-367
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000384
Family B-box zinc-binding domain 0.0036
Further Details:      
 
Weak hits

Sequence:  HGL_H00000286349
Domain Number - Region: 253-292
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0188
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000286349
Sequence length 470
Comment TRIM42 (Homo_sapiens) tripartite motif-containing 42
Sequence
MCVCSPCCTWQRCCPHLCSCLCCKFIFTSERNCTCFPCPYKDERNCQFCHCTCAENPNCH
WCCCSWANDPNCKCCCTASSNITCYYYESRCCRNATIIFHKGCLKSIRTSSKTTLHVGSS
DTQVDNLKSIPANSHLVDHLSCPMCNRLRLHSFMLPCNHSLCEKCLRRLQKQAEVTENFF
ILICPVCNRSHCMPYTHKMRLPENYLRGRLTKRYMQVCTSHCMPYTHKMRLPENYLRGRL
TKRYMQEHGFLKWRFDRSSGPILCQVCRNQRIAYKRCITCRLNLCNECLKAFHSDIAMQD
HVFVDTSAEDQDEKMCIHQPSSSISEYCRRELLCTFCKMAFHSSHDTVSLIDACSERSAA
LFSAIAKFKAVRYEIDNDLMEFNILKNNFKAAKETKRKEIRNGFLKLRSILHEKEKNIME
QIENLEVSRQKEIEKYVYITNLKVNEMDGLIAYSKEALKETGQVAFLRFL
Download sequence
Identical sequences G5APL6
HGL_H00000286349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]