SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000286835 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000286835
Domain Number 1 Region: 9-131
Classification Level Classification E-value
Superfamily ENTH/VHS domain 2.22e-27
Family RPR domain (SMART 00582 ) 0.0068
Further Details:      
 
Domain Number 2 Region: 460-586
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.93e-18
Family Canonical RBD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000286835
Sequence length 1146
Comment SFRS15 (Homo_sapiens) splicing factor, arginine/serine-rich 15
Sequence
SFSFKLFSLMDMKPPISRAKMILITKAAIKAIKLYKHVVQIVEKFIKKCKPEYKVPGLYV
IDSIVRQSRHQFGTDKDVFGPRFSKNITATFQYLYLCPSEDKSKIVRVLNLWQKNGVFKI
EIIQPLLDMAAGTSNAAPVAENVTNNEGSPPPPVKISSEPPQATPNSIPTVPQLPSSDAF
AAVAQLFQTTQGQQLQQILQTFQQPPKPQSPALDNAVMAQVQAITAQLKTAPTQPPEQKA
AFPPPEQKTAFDKKLLDRFDYDDEPEAVEESKKEDAAAILPAAPAAAAAATTAAASAPPV
PVVATPVPIAAAAPVAPAAASPPPQAPFGFPGDSMQQPTYTHQNMDQFQPRMMGIQDPMR
HQVPLPPNGQMPGFGLLPTPPFPPMAQPVIPPTPPVQQTFQPSFQAQTEQLTQKPHQQEM
EVEQPCIPEVKRHMSDNRKSRSRSASRSPKRRRSRSGSRSRRSRHRRSRSRSRDRRRHSP
RSRSQERRDREKERERRQKGLPQIKPETASVCSTTLWVGQLDKRTTQQDVASLLEEFGPI
ESINMIPPRGCAYIVMVHRQDAYRALQKLSRGNYKVNQKSIKIAWALNKGIKADYKQYWD
VELGVTYIPWDKVKPEELESFCEGGMLDSDTLNPDWKGIPKKPENDVAQNGGAETSHTEP
VSPIPKPLPVPVPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPTFTPPLGIPPPGFGPG
VPPPPPPPPFLRPGFNPMHLPPGFLPPGPPPPITPPVSIPPPHTPPISIPNSTIAGINED
TTKDLSIGNPIPTVVSGARGNAESGDSVKMYGSAVPPAAPTNLPTPPVTQPVSLLGTQGV
APGPVIGLQAPSTGLLGARPGLIPLQRPPGMPPPHLQRFPMMPPRPMPPHMMHRGPPPGP
GGFAMPPPHGMKGPFPPHGPFVRPSGIPGLGGPGPGPGGPEDRDGRQQPPAPPQQQAPPP
PQQQQPPSQQQPPAAQQQPQQFRNESRQQFNSGRDQERFGRRSFGNRVENDRERYGNRND
DRDNSNRERREWGRRSPERDRHRDSEERSRRSSGHRDRERDSRDRESRREKEEPRGKEKP
EVTDRASGNKATEPPLSRVGNVDTVSELDKGEAQATVAKPPEESPAEATSSVEPEKDSGS
AAEAPR
Download sequence
Identical sequences G5BEA5
HGL_H00000286835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]