SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000287461 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000287461
Domain Number 1 Region: 270-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.21e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 2 Region: 326-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 3 Region: 186-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 28-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-20
Family KRAB domain (Kruppel-associated box) 0.003
Further Details:      
 
Domain Number 5 Region: 381-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.08e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 423-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-18
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 7 Region: 150-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000307
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 8 Region: 232-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000565
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000287461
Sequence length 500
Comment ZNF689 (Homo_sapiens) zinc finger protein 689
Sequence
MAPPSAPLPAQGPGQAGPSRRRGTRPRALKFADVAVYFSPEEWGCLRPAQRTLYRDVMRE
TYGLLGALGCAGPKPALISWLERSTDDWEPAALDPQEYPRGVTVQRKNRTRKKSGEKEAF
SPKEAPRKGKRGRRPSKPRLIPRQTSGGTICPDCGCTFPDHPALESHKCAQNLKKPYPCP
DCGRRFSYPSLLVSHRRAHSGECPYVCDQCGKRFSQRKNLSQHQVIHTGEKPYHCPDCGR
CFRRSRSLANHRTTHTGEKPHQCTSCGRRFAYPSLLAIHQRTHTGEKPYTCVECSRRFRQ
RTALVIHQRIHTGEKPYPCPDCERRFSSSSRLVSHRRVHSGERPYACEHCEARFSQRSTL
LQHQLLHTGEKPYPCPDCGRAFRRSGSLAIHRSTHTEEKLHACEDCGRRFAYPSLLASHR
RVHSGERPYACDLCSKRFAQWSHLAQHQLLHTGEKPFPCLECGRCFRQRWSLAVHKCSPK
GPSCNTRSTPGGASHRGNTP
Download sequence
Identical sequences G5BYK9
XP_004856231.1.39548 HGL_H00000287461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]