SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000287482 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000287482
Domain Number - Region: 340-452
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00011
Family Myosin rod fragments 0.008
Further Details:      
 
Domain Number - Region: 174-398
Classification Level Classification E-value
Superfamily Tropomyosin 0.0111
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000287482
Sequence length 657
Comment SASS6 (Homo_sapiens) spindle assembly 6 homolog (C. elegans)
Sequence
MSQVLFQQLIPLQVKCKDCEERRISVRVSIELQSVSNPVHRKDLVIRLTDDTDPFFLYNL
VISEEDFQSLKFQQGLLVDFLAFPQKFIDLLQQCAQEHAKEIPRFLLQLVSPAAILDNSP
AFLNVVETNPFKHLIHLSLKLLPGNDVEIKKFLAGCLKCSKEEKLLLTQSLDDVTRQLNL
TKKTLSEKIQELDKLRNEWASHTASLTNKHSQELTNEKEKALQAQVQYQQQHEQQKKDLE
TLHQRNIHQLQNRLSELEAANKDLTERKYKGDSVTRELKAKLSGVEEELHRTKQEVLSLR
RENSTLDAECHEKEKHINQLQTKVAVLEQEIKDKDQLVVRTKEAFDTIQEQKVALEENGE
KNQVQLGKLEATIKSLSAELLKANEIIKKLQGDLKTLMGKLKLKNTVTIQQEKLLAEKEE
KLQKEQKELQDVGQTLRAKEQEVCKLQEQLEATVQKLEESKQLLKNNEKLITWLNKELNE
NQLVKKQDVLGPSTTPPAHSSSNTIRSGISPNLNVIDNRLAYPGCGIGYPVSSAFAFQNT
FPHPIPAKNTMYPVSGPKVQFNLQFTKPSTSLGDTHSGAAISVPCSTDKENGENLGLESK
YLKKREDSIPLRGLSQNLLSNADHQKDGTLGALQTSSKPTVLPSTSSAYFPGQLSSS
Download sequence
Identical sequences G5C723
XP_004869178.2.39548 HGL_H00000287482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]