SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000287936 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000287936
Domain Number 1 Region: 445-584,701-861
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 2.75e-114
Family Substrate-binding domain of HMG-CoA reductase 0.000000000102
Further Details:      
 
Domain Number 2 Region: 587-703
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 7.06e-45
Family NAD-binding domain of HMG-CoA reductase 0.000000472
Further Details:      
 
Domain Number 3 Region: 45-219
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.0000484
Family Multidrug efflux transporter AcrB transmembrane domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000287936
Sequence length 905
Comment HMGCR (Homo_sapiens) 3-hydroxy-3-methylglutaryl-CoA reductase
Sequence
MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGDNKVCGWNYECPKFEEEVLSS
DIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTG
LNEALPFFLLLIDLSRASALAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIG
VGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFAR
VLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADSSPQNSTTEQSKVSLGLDENVSKR
IEPSVSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQAETESTLSLKNPITSPVVT
QKKVPDNCCRREPMLVRNNQKFQAVEEETGINQERKVEVIKPLVAETDTSNRATFIVGGP
CSPDTPSDLVTQEPKIQLPTDPRPAEECLQILGNAEKGAKFLSDAEIIQLVNAKHIPAYK
LETLMETHERGVSIRRQLLSKKLPEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGV
AGPLCLDGKEFQVPMATTEGCLVASTNRGCRAISLGGGASSRVLADGMTRGPVVRLPRAC
DSAEVKAWLETPEGFAVIKEAFDSTSRFARLQKLHTSMAGRNLYIRFQSKTGDAMGMNMI
SKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKTVVCEAVIPAKVVREV
LKTTTEALIDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITL
MEASGPTNEDLYISCTMPSVEIGTVGGGTSLLPQQACLQMLGVQGACIDNPGENARQLAR
IVCGTVMAGELSLMAALAAGHLVKSHMIHNREVGGLFHTDGSDLNTAQCCTCYVLWKGLS
VDFTL
Download sequence
Identical sequences G5AVZ7
HGL_H00000287936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]