SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000288221 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000288221
Domain Number 1 Region: 26-245
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000085
Family Tropomyosin 0.0041
Further Details:      
 
Weak hits

Sequence:  HGL_H00000288221
Domain Number - Region: 241-328
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00366
Family Myosin rod fragments 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000288221
Sequence length 602
Comment ERC2 (Homo_sapiens) ELKS/RAB6-interacting/CAST family member 2
Sequence
MNRQAYFYRVPPQELHRRSQLQPEPAKTKALQTVIEMKDTKIASLERNIRDLEDEIQMLK
ANGVLNTEDREEEIKQIEVYKSHSKFMKTKIDQLKQELSKKESELLALQTKLETLSNQNS
DCKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKESFLNKKTKQLQDLTEEKGTLAG
EIRDMKDMLEVKERKINVLQKKIENLQEQLRDKDKQLTNLKDRVKSLQTDSSNTDTALAT
LEEALSEKRLEEIESFRKENKDLKEKVNALQAELTEKESSLIDLKEHASSLASAGLKRDS
KLKSLEIAIEQKKEECSKLEAQLKKAHNIEDDSRMNPEFADRLKQLDKEASYYRDECSKA
QAEVDRLLEILKEVENEKNDKDKKIAELERHMKDQNKKVANLKHNQQLEKKKNAQLLEEV
RRREDSMADNTQHLQIEELMNALEKTRQELDATKARLASTQQSLAEKEAHLANLRIERRK
QLEEILEMKQEALLAAISEKDANIALLELSASKKKKTQEEVMALKREKDRLVHQLKQQTQ
NRMKLMADNYDEDHHHYHHHHHHHHHRSPGRSQHSNHRPSPDQVSFIAAYLQGSFYPSDI
LR
Download sequence
Identical sequences G5ATM3
HGL_H00000288221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]