SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000288235 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000288235
Domain Number 1 Region: 9-736
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.08e-258
Family Motor proteins 0.0000000000146
Further Details:      
 
Domain Number 2 Region: 1044-1107
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-23
Family SH3-domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000288235
Sequence length 1108
Comment MYO1E (Homo_sapiens) myosin IE
Sequence
QGSKGAFRYHWQSHNVKHSGVDDMVLLSKITESSIVENLKKRYMDDYIFTYIGSVLISVN
PFKQMPYFGEKEIEMYQGAAQYENPPHIYALADSMYRNMIIDRENQCVIISGESGAGKTV
AAKYIMSYVSRVSGGGPKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSP
GGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGTSAEQKHSLGITSMDYYYYLSL
SGSYKVDDIDDKREFQETLHAMNVIGIFSEEQTLVLQIVAGILHLGNISFKEVGNYAAVE
SEEFLAFPAYLLGINQDRLKEKLTSRQMDSKWGGKSESIHVTLNVEQACYTRDALAKALH
ARVFDFLVDSINKAMEKDHEEYNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELT
LKAEQEEYVQEGIRWTPIEYFNNKIVCDLIENKVNPPGIMSILDDVCATMHAVGEGADQT
LLQKLQMQIGNHEHFNSWNQGFIIHHYAGKVSYDMDGFCERNRDVLFMDLIELMQSSELP
FIKSLFPENLQADKKGRPTTAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPRDWEE
SRVKHQVEYLGLKENIRVRRAGYAYRRVFQKFLQRYAILTKATWPVWHGDEKQGVLHLLQ
SVNMDSDQFQLGRSKVFIKAPESLFLLEEMRERKYDGYARVIQKSWRKFVARKKYVQMRE
EASDLLLNKKERRRNSINRNFIGDYIGMEEHPELQQFVGKREKIDFADTVTKYDRRFKGV
KRDLLLTPKCMYLIGREKVKQGPDKGLVKEVLKRRIEMERILSVSLSTMQDDIFILHEQE
YDSLLESVFKTEFLSLLAKRYEEKTQKQLPLKFSNTLELKLKKENWGPWSAGGSRQVQFH
QGFGDQAILKPSNKVLQVSIGPGLPKNSRPTRRNTTQNRDYSSRTQNANYPMRAAPPPPG
YHQNGVIKNQFVPHPQGLGNQRTNQKSLYTSMARPPLPRQQSTGSDRLSQTPESLDFLKV
PDQGAAGVRRQTTSRPPPAGGRPKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDVIDI
IKEDPSGWWTGRLRGKQGLFPNNYVAKI
Download sequence
Identical sequences G5AWC9
HGL_H00000288235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]