SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000289968 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000289968
Domain Number 1 Region: 10-230
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.49e-53
Family BAR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 241-434
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000289968
Sequence length 814
Comment ARHGAP17 (Homo_sapiens) Rho GTPase activating protein 17
Sequence
MPDTMCAKQGAEKTEVLSEDLLQIERRLDAVRSMCHHSHKRLIACFQGQHGTESERRHKK
LPLTALAQNMQEASTQLEESLLGKMLETCGDAENQLALELSQHEVFVEKEIVDPLYSIAE
VEIPNIQKQRKQLARLVLDWDSVRARWNQAHKSSGTNFQGLPSKVDTLKEEMDEAGNKVE
QCKDQLAADMYNFVAKEGEYGTFFVTLLEAQADYHRKALAVLEKALPEMRAHQDKWAEKP
AFGTPLEEHLKRSGREIALPIEACVMLLLETGMKEEGLFRIGAGASKLKKLKAALDCSTS
HLDEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWTQVASVQDQDKKLQDLWRTCQKLP
PQNFVNFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWAKNEGTLAEIAAATSVHVV
AVIEPIIQHADWFFPEEVEFNVSEAFVPLATPNSNQSSHTGNDCDSGAPERKRPASMAVM
EGDLVKKESFGVKLMDFQAHRRSGTLNRKHVSPAFQPPLPPTDGSTAAPAAPEPPAHSSR
AESSSGGGTVPSSAGIPEQGPGPGDSSPPKPKDSTPAAVPASGRSSSQTTPGQAQAQAQS
GAGPHQLSVGPAHSAAGPSPHTLRRASSRGAAYTQEGCAVSWELTVASMSTSPGPVDQLA
PATELTPSMDLLSCSCLLYSILPGIFVSFLALRSQLKVTSSTEPAPSPPYLQAVSGPETA
QPHTGTLPRPRPVPKPRNRPSMPPPPHPPGAHPAGDGSLTGAALTSSRIGTDTNSRVSEP
PRNIFPEMHSDSASGEAPGHILLDMDNDTESTAL
Download sequence
Identical sequences G5B945
HGL_H00000289968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]