SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000290277 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000290277
Domain Number 1 Region: 301-586
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.22e-66
Family Protein kinases, catalytic subunit 0.0000000109
Further Details:      
 
Domain Number 2 Region: 20-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.31e-22
Family Ras-binding domain, RBD 0.0000213
Further Details:      
 
Domain Number 3 Region: 92-144
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000290277
Sequence length 606
Comment ARAF (Homo_sapiens) v-raf murine sarcoma 3611 viral oncogene homolog
Sequence
MEPPRGPPANEAEPSRTVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRQQIYHSVQDLSRGTRQHEAPSNHPLNEPL
TPQGLSPCTQHCEPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTTPMDSGLMQLTAQSFS
TDAAGGRGSGDGGPRGSPSPGSVSSGRKSPHSKSPSEQRERKSLAEEKKKVKNLGYRDSG
YYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVLRK
TRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYL
HAKNIIHRDLKSNSIYLFLGWIVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRM
QDPNPYSFQSDVYAYGVVLYELMTSSLPYSHIGSRDQIIFMVGRGYLSPDLSKISSNCPK
AMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLS
AARLVP
Download sequence
Identical sequences G5B0C3
HGL_H00000290277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]