SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000290341 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000290341
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.56e-24
Family Canonical RBD 0.00029
Further Details:      
 
Domain Number 2 Region: 396-479
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.96e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 3 Region: 276-355
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000145
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 4 Region: 484-562
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 5 Region: 192-268
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000290341
Sequence length 577
Comment IGF2BP1 (Homo_sapiens) insulin-like growth factor 2 mRNA binding protein 1
Sequence
MNKLYIGNLNESVTPADLEKVFAEHKISYSGPFLVKSGYAFVDCPDEHWAMKAIETFSGK
VELQGRRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETA
VVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQISQGPENGRRGGFGSRGQPRQG
SPVAAGAPAKQQQVDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAA
EKAISVHSTPEGCSSACRMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLK
KVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEITKKVREAYENDVAAMSL
QSHLIPGLNLAAVGLFPASSSAVPPPPSSVSGAAPYSSFMQAPEQEMVQVFIPAQAVGAI
IGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVIITGPPEAQFKAQGRIYGKLKEENFF
GPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVVVKII
GHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK
Download sequence
Identical sequences G5C4N4
HGL_H00000290341 XP_004859692.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]