SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000290472 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000290472
Domain Number 1 Region: 264-790
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.33e-142
Family Lysophospholipase 0.000000469
Further Details:      
 
Domain Number 2 Region: 7-124
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.64e-25
Family PLC-like (P variant) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000290472
Sequence length 802
Comment PLA2G4D (Homo_sapiens) phospholipase A2, group IVD (cytosolic)
Sequence
QGEASACWRLTVRVLEAWRLHRVDLLSEADPYVILQLPTSPGMKFRTKTVSNSSHPVWNE
TFSFLIQSRVKNVLELGIYDEDLITKDDICFKVFYDISEVLPGKLLQKTFFLGPQGQEEL
DVEFLVEETPGPPEYLITNNVLVARELSRLDVHLDRAGSTPGGADWGKLELELVLKGSFE
DTQTSALGTASAFRFHYLAAQDTELHGRLKSSRSSGWNTDSSAGHFTVPLQSLAGGREVT
ICVPATDDPGVRLQLKADSCPKELDVRLGFDLCVEEQAFLSRRKQVVAMALKQALQLDRD
LQEEEVPVVGIMAEGGGARAMTSLCGHLLALQKLGLLDCVTYLSGISGATWAMAHLYGDP
EWSQKDLQGPISHIRKHMAKSKLRAFSPQSLASYWHKLQLRASQGHPTTAVDLWALLLEF
SLHGQVADQTLSGQRDALERGQNPLPLYLSLNVKEDTVDTLHFKEWVEFTPYEVGFLKYG
AFVPPELFGSEFFMGRLMRRLPESPICFLEAIWSNIFSLNLMDTWYNLAWSGEEWKQHVK
EEIHSTEEPEDCLRTSLWTEASWLQPGTALARAFKGVLTGRPLCHHGANFLHGLQLHQGY
SGQKDFSTWADCQSDSTPSQLTPQQPQLCLVDAGYLINNSYPSMFRPGRRLDLILYFGYS
LSSHFEALQQAELYCRTQGLHFPHVEISAEDRCQPRECYLFADPTCPEAPVLLYFPLVNV
SFKDHSTPGVWRSPEELWAGQVDLNKTTTPYFLLNMTYSEEDFDHLLQLNDYNLQNSQDT
ILQALRMALKHRAPEARPQGAQ
Download sequence
Identical sequences G5BM23
HGL_H00000290472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]