SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000291182 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000291182
Domain Number 1 Region: 542-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.82e-25
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 430-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 486-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.32e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 27-85
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.28e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 6 Region: 332-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-19
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 7 Region: 583-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.77e-18
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 270-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000942
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000291182
Sequence length 672
Comment ZNF235 (Homo_sapiens) zinc finger protein 235
Sequence
MESSCCERVEALPLTEGEVGSVISLGKEAVTFKDVAVVFSEEELGLLDSAQRKLYRDVML
ENFRNLLSVGHQSFKPDVISQLEREEKLWMTEIQTQRGNRNQNKMEILHEAGLRCLSLGE
LSRWQIKRHILNKLAQSQDSIINIQGKSSWFPKQCDSSCHMRAEESCQASIEDSCLVNLL
EDRSNVIENQEFPTERAQSPWSKIYLSETQNQQNNYKPTQMKNKLCIFAPCVDILSCISH
HRDDSVVHKMEEAHSHSTCGKEVLKVSAFTQHCIYTGQRNYPCSECEAAFIDCYNLELHQ
QVHLGKKSPMCSISEEDTSYSPSIPVQQNVRTGKKRYWCHECGKGFSQSSNLQTHQRVHT
GEKPYTCPECGKSFNQSSHLYAHLPIHTGEKPYRCDSCGKGFSRSTDLNIHCRVHTGEKP
YKCEVCGKGFTQRSHLQAHERIHTGEKPYKCGDCGKRFSCSSNLHTHQRVHTEEKPYKCD
ECGKCFSLSFNLHSHQRVHTGEKPYKCEECGKGFSSASSFQSHQRVHTGEKPFRCNVCGK
GFSQSSYFQAHQRVHTGEKPYKCEVCGKRFNWSLNLHNHQRVHTGEKPYKCEECGKGFSQ
ASNLQAHQSVHTGEKPFKCDACQKVFLYSVLFHMVTPQPLEPTWKPASPGSQDKCYGLFY
SDLGIHIITADE
Download sequence
Identical sequences G5CBN8
HGL_H00000291182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]