SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000291416 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000291416
Domain Number 1 Region: 228-410
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-55
Family SPRY domain 0.0000352
Further Details:      
 
Weak hits

Sequence:  HGL_H00000291416
Domain Number - Region: 77-179
Classification Level Classification E-value
Superfamily Tropomyosin 0.0111
Family Tropomyosin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000291416
Sequence length 414
Comment TRIM62 (Homo_sapiens) tripartite motif-containing 62
Sequence
MWRGGNRFQSKAGDQWDWFGDGSFVMHDSQVSGWDGVGMCPSPRFRRKGQASSLSVFRTP
ASGKNLSTSLGGLNNRELKEQLQALQDSEREHTEALQLLKRQLSETKSSTKSLRTTIGEA
FERLHRLLRERQKAMLEELEADTARTLTDIEQKVQRYSQQLRKVQEGAQILQERLAETDR
HTFLAGVASLSERLKGKIHETNLTYEDFPTSKYTGPLQYTIWKSLFQDIHPVPAALTLDP
GTAHQRLILSDDCTIVAYGNLHPQPLQDSPKRFDVEVSVLGSEAFSSGVHYWEVVVAEKT
QWVIGLAHEAASRKGSIQIQPSRGFYCIVMHDGNQYSACTEPWTRLNVRDKLDKVGVFLD
YDQGLLIFYNADDMSWLYTFREKFPGKLCSYFSPGQSHANGKNVQPLRINTVRI
Download sequence
Identical sequences G5B5K7
HGL_H00000291416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]