SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000291576 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000291576
Domain Number 1 Region: 290-646
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.63e-64
Family Quinoprotein alcohol dehydrogenase-like 0.02
Further Details:      
 
Domain Number 2 Region: 30-228,277-357
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 3.07e-22
Family SGL-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000291576
Sequence length 902
Comment PWP2 (Homo_sapiens) PWP2 periodic tryptophan protein homolog (yeast)
Sequence
MKFAYRFSNLLGTVYRRGNLNFTCDGNSVISPVGNRVTVFDLKNNKSDTLPLAMSFNVKC
MGLSPDGRLAIIVDEGGAALLVSLACRSVLHHFHFKGSVHSVSFSPDGRKFVVTKGNIAQ
MYHAPGKKREFNAFVLDKTYFGPYDETTCIDWTDDSRCFVVGSKDMSTWVFGAERWDNLI
YYALGGHKDAIVACFFESNSLDLYSISQDGALCVWQCDTPPEGLRLKAPTGWKADLLQRE
QEEEEDERQTTIRGKATVAEEERKGKVKYLRLAKYFFNKEGDFNNLTSAAYHKKVHLLVT
GFASGNFHLHELPEFNLIHSLSISDQKISSIAINSSGDWIAFGCSGLGQLLVWEWQSESY
VLKQQGHFNSMVSLAYSPDGQYIVTGGDDGKVKVWNTLSGFCFITFTEHSSGVTGVTFTA
TGYVIVSSSMDGTVRAFDLHRYRNFRTFTSPRPTQFSCVAVDSSGEIVSAGAQDSFEIFV
WSMQTGRLLDVLSGHEGPISGLCFNPTKSVLASASWDRTVRLWDMFDSWRAKETLTLTSD
ALAVTFRPDGAQLAVATLSSQIIFWDPESAVQTGSIEGRHDLKTGRKELDKISAKHSAKG
KAFTTLCYSADGQCILAGGMSRFVCLYHVREQILVKRFELSCNLSLDAMEEFLNRRKMTE
FGNLALIDQDAGEDGVAIPLPGVRKGDMSSRHFKPEIRVSSLRFSPTGRCWAATSTEGLL
IFSLDDRMLFDPYELDTSVTPGRVREVLRQGEFTRAILMAFRLNERTLMQEALEAVEVVS
ASLPELYVEKLLEFLASSFEGCRHLEFYLIWTQKLLTQHGQKLKPRAGQLLPTVQFLQKG
VQRHLEDVAKLCDWNRYNIQYALAVSRQRGVKRTLEAPGAEEEDSLHLIRGSEDEGEEAM
LA
Download sequence
Identical sequences G5BG18
HGL_H00000291576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]