SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000291598 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000291598
Domain Number 1 Region: 437-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.28e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.72e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 241-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 5 Region: 381-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.39e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 203-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 7 Region: 483-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 8 Region: 344-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000597
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000291598
Sequence length 562
Comment ZNF583 (Homo_sapiens) zinc finger protein 583
Sequence
QDLVTFGDVSINFTQEEWEWLNPVQRNLYRKVMLENYRSLVSLGVSVSKPDVISLLEQGK
EPWMMKEGTGDVCPDWEDVFKTNEFSSEQDIYEESAKVVTMGRSRLSYTLDYPNLKENCE
IEDWFENKLGSQEVHSSQLIIKHKEILPKDQSNKYNKSWQTFQHDAIVDIKQNFPYKRKS
SISRSYRKKSIEMKYKKVYVEKKLLKCNECEKVFNQSSSLTLHQRIHTGEKPYACVECGK
SFSQSANLAQHKRIHTGEKPYECKECRKAFSQNAHLAQHQRVHTGEKPYQCKECKKAFSQ
IAHLTQHQRVHTGERPFECIECGKAFSNGSFLAQHQRIHTGEKPYLCNVCGKAFSHRGYL
IVHQRIHTGERPYECKECRKTFSQYAHLAQHQRVHTGEKPYECKVCRKAFSQVAYLDQHQ
RVHTGEKPYECVECGKAFSNSSSLAQHQRSHTGEKPYMCKECRKTFSQNAGLAQHQRIHT
GEKPYECNVCGKAFSYSGSLTLHQRIHTGERPYECKDCRKSFRQRAHLAHHEKIHTMEAL
LTFSSPSPSPSNQLPRPVGFIS
Download sequence
Identical sequences HGL_H00000291598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]