SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000291688 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000291688
Domain Number 1 Region: 436-490
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000735
Family Canonical RBD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000291688
Sequence length 1981
Comment MCM3AP (Homo_sapiens) minichromosome maintenance complex component 3 associated protein
Sequence
MNPVNPFIGQQPSAFAASSSGTAGTFQSKPPFRFGQPSLFGQNNTLSGKSPGFSHMPSFG
TPSGITHSSGQTFGLTQTSSSGLFSGLERAPPFVATSGPSSSSVPGNPGFSFKSPTSLGV
FSSTTAFGSEAGEVVSSGFGKTEFSFKPLENAVFRPILGTESEPEKTQSQITSGFFTFSH
PVNSGPGGPTPFSFSQVTSSSAPNSSFIFSKPVNSNNSSSPFNPALSNQNVEEEKRGPKS
VFGSCNSNFSSFPVSSGSLGEPFSVNKSGVRQGCEEAVSQVEPLPGLMKGLKRKEDQDCS
PRRHGYEAAEDSDPMSRGDHPPDKRPVRLNRPRGGTLFGRTIQDVFKSNKEVARLGNKEY
KKESGFVESGESDHIAISGGGQSILAPSRLPGINKEEETESRNKKEESVRGTPVHQSKRS
ESTDSLGRLSPTEVTAIQCKNIPDCLNDRTTLENYFSKIAQVQRIFIRRSKKLAVVHFFD
HASAALARKKGKSLHKDVAIFWHKKKISPNKKPFSPKEKKPGDGEASQGPEDLPFQHSHL
GKAAVRAAAGGLLSKSSPVKKPSLLKAHQFEVDVFDSGSECSEGLGTCVSSLSALIGTVA
ETSEEKYRLLDQRDRIMRQARVKRTDLDKARTFVGICPDMCPEKERYMRETRSQLSVFEV
VPGTDQVDHAAAVKEYSRSSADQEEPLPHELRPSAVLSRTMDYLVTQIMDQKEGSLRDWY
DFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSFDAKINNENMT
KCLQSLKEMYQDLRGRGVFCASEAEFQGYNVLLSLNKGDILREVQQFHPDVRNSPEVHFA
VQAFAALNSNNFVRFFKLVQSASYLSACLLHCYFNQIRKDALRALSIAYTVSTQRSTAFP
LDGVVRMLLFRDGEEATDFLNCHGLTVSEGCVELNRSAFLEPEGLSKARKSVFITRKLTV
SVGEVVNGGPLPPVPRHTPVCSFNAQNKYVGEGLATELPVGPPRASIDGAGDRKGEECGA
EPDVPLPGLLPQPLLLPVPLPAPLPHAPLQSLSAAPSLFQPSVQPELLPPKTAPVYSDAD
LAQVVDELIQEALQRDCEEVGTAGAAYAAAALGVSNAAMEDLLTAATTGILRHVAAEEVT
KERERKEEEKRRAEEERLKQERELVLAQLSQGLAEELTELMVMECVWETCSQELKSAVEI
DQRVRVARCCEAVCAHLVDLFLAEEIFQTVKETLQELQCFCKYLQRWREAVAARKKLRRQ
MRAFPAAPCCVDVNDRLWALVPSAECPIAKENLVRSLLDLGHAGKVGISCTRLRRLRNKT
AHQMKVQHFHQQLLSNAVWAPLDLPSLVAEHLPMRQEREFWKLVLVLPDEEKQSPGSPGR
ILADWLKVKFMGDDGLVGDTCSNAGEIQTLTIFNALSSKKDKIVSVSVCIKVVHGTLGDA
ALDAVATKKDLLGASGLMLLLPPRVKTEDAAEEDMYWLSALVQLKQFLQAKPFLPSLPLV
VLVPGSGEDPIGKDVEDGLMLQDLVSAKLISDYIVTEIPDSINDLQGTKKVSWAVQWLVS
RCPHALDLCCQTLTQYVEDGVDREFSGRFFHDRRERHLGGLASQEPSTIVELFNSVLQFL
ASVVSSEQLCDLSWPVPEFAEAGGSQLVPHLHWNSPEHLAWLRQAVLGFQLPQMDLPPPE
APWLPVCSMVVQYTSQIPSSRQAQPILQSQVENLLRTTYRRWKSKSSFLGQGAGPSVTDI
PWDDIIALCINHKLRDWTPPRLPVISGAQSEDGQICVYFFKKHLKKYDVPLSWERARVQT
QKELQLNPGCLGIKTFHPSASSFPTPLLHLHHKGKRNAECCRLGRSLSAEDLVRGASAEE
LLAECLSSSLLQEKEDNKRFEDQLQQWLSQDLGALTDSTSLPFYLPQTLLSLPQTIESVV
KTSTTSSPQNARTKEQLQLSEETDTSLTERLKYLERLIQSSREEELASKLHLSALLDMVD
I
Download sequence
Identical sequences G5C7V5
HGL_H00000291688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]