SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000291906 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000291906
Domain Number 1 Region: 540-858
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-87
Family Protein kinases, catalytic subunit 0.000000105
Further Details:      
 
Domain Number 2 Region: 163-237
Classification Level Classification E-value
Superfamily HR1 repeat 3.27e-22
Family HR1 repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 92-153
Classification Level Classification E-value
Superfamily HR1 repeat 2.09e-18
Family HR1 repeat 0.00037
Further Details:      
 
Domain Number 4 Region: 3-70
Classification Level Classification E-value
Superfamily HR1 repeat 4.71e-18
Family HR1 repeat 0.00043
Further Details:      
 
Domain Number 5 Region: 316-406
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000216
Family PLC-like (P variant) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000291906
Sequence length 873
Comment PKN3 (Homo_sapiens) protein kinase N3
Sequence
QAGPGPRPLEDEKEVIRRAIQKELKIKEGMENLRSVATDRRHLGHVQQLLQSSNRRLEQL
HSELRELHARILLPGLAEPVASGPRLRAEQSKARHLEALRRQLQVELKVKQGAENMTHTY
ASGTPKERKLLAAAQQMLRDSQLKVALLRMKISSLEASGSPEPGPELLAEELQHRLHIEA
AVAEGAKNVVKLLGGRRTQDRKALAEAQAQLQESSQKLDLLRLALDQLLESLPPAHPLRG
RVARKLRVAVLGNTQPAGTLVKPTALTGTLQVHLLGCEKPLAVVPGRSPVAALAGSPSEG
WLWARARQQRSGGELSSELLAVLKVDNRAVGQTGWGQVAERCWDQTFAIPLERARELEIG
VHWRDWRQLCGVAFLRLEDFLDNACHQLSLSLVPQGRLFVQVTFCDPVLERRPRLQRQKR
VFSKRRGQDFLRASQMNLSMAAWGRLVMSLLPPCSSPSTTSPPKGCSQTPTAPRGAFEPP
SPSTLPKKTPLGEEIQPPPKPPRLFLAQEETPRTKRPHMEPRPGLVPAPPPSPARRPPQL
QDFRCLAVLGRGHFGKVLLVQFKGTGKYYAIKALKKQEVLSRDEVESLYCEKRILEAVGR
TGHPFLLSLLACFHTSSHACFVTEFVQGGDLMMQIHEDVFPEPQARFYLACVVLGLQFLH
EKKIIYRDLKLDNLLLDAQGFLKIADFGLCKEGIGFGDRTSTFCGTPEFLAPEVLTQETY
TRAVDWWGLGVLLYEMLVGECPFPGDTEEEVFDCIVNTDAPYPHFLSVQALELIQKLLQK
CPEQRLGAGDQDAEEIKAQPFFRVTDWQALLARAVQPPFVPTLCGPADLRYFEGEFTGLL
PALTPPGPRSPLSAHQQAAFQDFDFVSERFLQP
Download sequence
Identical sequences G5ASE2
HGL_H00000291906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]