SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000292450 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000292450
Domain Number 1 Region: 33-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.87e-39
Family SCAN domain 0.0000482
Further Details:      
 
Domain Number 2 Region: 363-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 270-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-19
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 4 Region: 409-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-18
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 5 Region: 308-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.99e-18
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000292450
Sequence length 468
Comment ZSCAN21 (Homo_sapiens) zinc finger and SCAN domain containing 21
Sequence
MATVLGPRPPQQQLGPVILKVKEEEEKGKCLPSLEIFRQRFRQFGYHDTPGPREALSQLR
VLCCEWLRPELHTKEQILELLVLEQFLTILPPELQAWVQEHCPESAEEAVTLLEDLEQEL
DEPGLQVSTPPNEQKQVWEMSTAGAAKESPSSVHSLEASPKYESWGPLYIQETGEEEDLT
RDPRKSRDCKLSHPQNEESADEQNSSKEESGADGLEKDIIPVIIANKCEARSDRPWVNLE
KQRGVKTALQETGSKKRADSAPTKPTPGERRYICAECGKAFSNSSNLTKHRRIHTGEKPY
VCTKCGKAFSHSSNLTLHYRTHLVDRPYDCKCGKAFGQSSDLLKHQKMHTEEAPYQCKDC
GKAFSGKGSLIRHYRIHTGEKPYQCNECGKSFSQHAGLSSHQRLHTGEKPYKCKECGKAF
NHSSNFNKHHRIHTGEKPYWCSHCGKTFCSKSNLSKHQRVHTGEGEVL
Download sequence
Identical sequences G5AN11
HGL_H00000292450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]