SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000292928 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000292928
Domain Number 1 Region: 387-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-26
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 443-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.65e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 303-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-22
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 4 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 485-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.29e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 265-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000344
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 7 Region: 195-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000209
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 8 Region: 350-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000461
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000292928
Sequence length 549
Comment ZNF382 (Homo_sapiens) zinc finger protein 382
Sequence
MPLQGSVSLKDVTVDFTEEEWQQLDTAQKALYMDVMLENYCHFISMGFHITNPETIHELE
QGEELWTERIFPSQSYLKDEKPEAVLMKFREYQDIHSRSVIFINHKKTVKERSNIYGKTL
TLGKNHIISKTLYEHKSDGKVLKNISELVIRNINPVKEKVGESNGWQKSILNTKHEKIHP
AVNLHKQTERNLSGKQELTQQQKVQTPEQPFECNECDKSFLMKGMLFSHNGAHKRERTFE
YNKNGIGFMEKCELGVHPHNLIEKKPSEYSKYGKFLCRKPVFIMHQRSQTEEKPFQCPYC
GNSFRRKSYLIEHQRIHTGEKPYVCNQCGKAFRQKTALTLHEKTHIEGKPYLCLDCGKSF
RQKATLTRHHKTHTGEKAYECTQCGSAFRKKSYLIDHQRTHTGEKPYQCNECGKAFIQKT
TLTLHQRIHTGEKPYQCNECGKAFIQKTTLTLHQRIHTGEKPYICNECGKSFRQKAILTV
HHRIHTGEKSNGCPQCGKAFSRKSNLIRHQKTHTGEKPYECKECGKFFSCKSNLIVHQKT
HKVESMRIL
Download sequence
Identical sequences G5BK02
HGL_H00000292928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]