SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000293218-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000293218-1
Domain Number 1 Region: 290-320
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000053
Family CCCH zinc finger 0.0039
Further Details:      
 
Weak hits

Sequence:  HGL_H00000293218-1
Domain Number - Region: 213-244
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00667
Family CCCH zinc finger 0.0061
Further Details:      
 
Domain Number - Region: 649-721
Classification Level Classification E-value
Superfamily Tropomyosin 0.015
Family Tropomyosin 0.01
Further Details:      
 
Domain Number - Region: 90-112
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0353
Family CCCH zinc finger 0.0057
Further Details:      
 
Domain Number - Region: 121-157
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0589
Family CCCH zinc finger 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000293218-1
Sequence length 810
Comment UNK (Homo_sapiens) unkempt homolog (Drosophila)
Sequence
MSKGPGPGGSAASSAPPAATAQVLQAQPEKPQHYTYLKEFRTEQCPLFVQHKCTQHRPYT
CFHWHFVNQRRRRSIRRRDGTFNYSPDVYCTKYDEATGLCPEGDECPFLHRTTGDTERRY
HLRYYKTGICIHETDSKGNCTKNGLHCAFAHGPHDLRSPVYDIRELQAMEALQNGQTTVE
GSIEGQSAGAASHAMIEKILSEEPRWQETAYVLGNYKTEPCKKPPRLCRQGYACPYYHNS
KDRRRSPRKHKYRSTPCPNVKHGDEWGDPGKCENGDACQYCHTRTEQQFHPEIYKSTKCN
DMQQSGSCPRGPFCAFAHVEQPPLSDDLQPSSAVSSPTQPGPVLYMPSAAGDSVPVSPSS
PHAPDLSALLCRSSSLGSPSNLCGSPPGPSRKPPNLEGLIFPGESSLAPGSYKKAPGFER
EDQVGAEYLKNFKCQAKLKPHSLESRSQEQPLLQPKQDVLGILPVGSPLTSSISSSITSS
LAATPPSPAGTSSTPGMNANALPFYPTSDTVESVIESALDDLDLNEFGVAALEKTFDNST
VPHPSSITIGGSLLQSSAPVNIPGSLGSSASFHSASPSPPVSLSSHFLQQPQGHLSQSEN
TFLGTSASHGSLGLNGMNSSIWEHFASGSFSPGTSPAFLSGPGAAELARLRQELDEANGT
IKQWEESWKQAKQACDAWKKEAEEAGERASAAGAECELAREQRDALEVRVKKLQEELERL
HTGPDPQALPTFPDLEALSLSTLYSLQKQLRAHLEQVDKAVFHMQSVKCLKCQEQTRAVL
PCQHAVLCELCAEGSECPVCQPSRAHTLQS
Download sequence
Identical sequences G5BNA3
XP_004860766.1.39548 HGL_H00000293218-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]