SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000293218-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000293218-2
Domain Number 1 Region: 307-339
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000647
Family CCCH zinc finger 0.0037
Further Details:      
 
Weak hits

Sequence:  HGL_H00000293218-2
Domain Number - Region: 245-332,709-740
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0116
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number - Region: 595-662
Classification Level Classification E-value
Superfamily Tropomyosin 0.0229
Family Tropomyosin 0.019
Further Details:      
 
Domain Number - Region: 111-128
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0647
Family CCCH zinc finger 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000293218-2
Sequence length 755
Comment UNK (Homo_sapiens) unkempt homolog (Drosophila)
Sequence
MATQTCSRVKLQPLLHLLTLDLYGFPRQIVLSYPKASNQAAVPASVSSPYRYLKEFRTEQ
CPLFVQHKCSQHRPFTCFHWHFLNQRRRRPLRRRDGTFNYSPDVYCSKYDEATGLCPDGD
ECPYLHRTTGDTERKYHLRYYKTGTCIHETDARGHCVKNGLHCAFAHGPLDLRPPVCDIR
ELQAQEALQNGQLGGGDGVPDLQPGVLASQAMIEKILGEDPRWQDTNFVLGSYKTEPCPK
PPRLCRQGYACPHYHNGRDRRRDPRKFPYRSTPCPSVKHGDEWGEPSRCDSGDSCQYCHS
RTEQQFHPEIYKSTKCNDMRQTGYCPRGPFCAFAHVEKTLGTASDWGCHDLSSASSTAAH
CSQPGNAKRRDSPADGSQKASDPDGKQNHLAVFTVVHPLAPSVSSSVASSLASSAGSGSS
SPTALPALPTRGPMLDPAGNTVEAVLGSALDLRLSDINIASLDKDLEDSDARDLGLTGPR
SLAGSAPVAIPGSLPRSPSLHSSSSLSTSPLSSLSQSLSGPLTASAMTPPQQPPPLRSEP
AALGSTASSYSSLGLNGVPGSIWDFVSGSFSPSPSPILNTGPPVSSPNGAELARVRRQLD
EAKRKIRQWEESWQQVKQACDAWQREAQEAKERARMADSDRQLALQRKEEVEAQVKQLQE
ELEGLGLLSSLPGLRSCGDIGSIPLPKLHSLQSQLRLDLEAVDEVIFQLHAKQCVACREQ
ACDTTLQPCQHRVLCEPCAASAPECPYCKGQPLPW
Download sequence
Identical sequences G5BXT1
HGL_H00000293218-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]