SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000293350 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000293350
Domain Number 1 Region: 31-475
Classification Level Classification E-value
Superfamily ALDH-like 9.03e-80
Family ALDH-like 0.0000176
Further Details:      
 
Domain Number 2 Region: 486-759
Classification Level Classification E-value
Superfamily ALDH-like 3.01e-44
Family ALDH-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000293350
Sequence length 793
Comment ALDH16A1 (Homo_sapiens) aldehyde dehydrogenase 16 family, member A1
Sequence
MAETHARPSVREIFSTLEYGPAPESHACALAWLDAQNRLLGHYVNGKWLKPEHRNSVPCQ
DPVTGENLANCLLAEPDDVAAAVKAALDARGSWSGVPGGERAQHLTRLAKMIQKHQQLLW
TLDSLLTGRAIREVRSGDVPLAQQLLQYHAVQAHVQEEVLAGWKPMGVIGLILPPTFSFL
EMMWRICPALAVGCTVVAIVPPGSPSTLLLAQLAGGLGTFCGILNVIVGPASLGPTLGRC
PGVQKVAFCGAAESLAGHRLELSLALDLESLLLVMDSADLDSAVEGVVDAAWSDRSPGGL
RLLVQESVWEETMRRLQSRMRRLRSGPGLDGAVDMGTRGAAACDVAQRCVQEARSQGAEV
NQSASQVAHPPTLVSGLPPPPPCAQAEVPWPLVMASPFRTAKEALAMANSTPRGGSASVW
SERLGQALELAYGLRVGTVWINTHGLRDPAVPIGGCKESGSSWHGGLDGLYEYLQPSGTP
GQLPFVFEHLNYDSFGLALPTALPAWPKTGPSPVPPYGLFIRGRFQPSGAGSSRPIWDSS
GKLHGYVAEGAAEDVRGAVEAAHQAATGWERQSPGARAALLVALAAALEHRGPGLASRLQ
RHGVELEAAKVEVELSARRLRAWAAQAQAQAQGHTLQVAGLRGPVLRLREPLGVLAVVCP
DEWPLLAFVSLLAPALAHGNTVVLVPSGTCPLLALEICQDVASLFPAGLVNVVTGDRDHL
TRCLALHQDVQALWYFGSAEGSQFVEWASAGNLKPVWVNSGCPRAWEQEPQGAGPELRLR
AARTKALWLPMGD
Download sequence
Identical sequences G5B8N9
HGL_H00000293350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]