SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000293677 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000293677
Domain Number 1 Region: 149-316
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.08e-29
Family Canonical RBD 0.0032
Further Details:      
 
Domain Number 2 Region: 73-147
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.37e-16
Family Canonical RBD 0.0000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000293677
Sequence length 756
Comment RAVER1 (Homo_sapiens) ribonucleoprotein, PTB-binding 1
Sequence
MPLRPSSLVPEGAGFPKMAADVSVTHRPQLSPEPGAEAEATETAERRTPEELPPLDPEEI
RKRLEHTERQFRNRRKILIRGLPGDVTNQEVHDLLSDYELKYCFVDKYKGTAFVTLLNGE
QAEAAINAFHQSHLRDRELSVQLQPTDALLCVANLPPSLTQAQFEELVRPFGSLERCFLV
YSEHTGQSKGYGFAEYMKKDSAARAKSDLLGKPLGPRTLYVHWTDAGQLTPALLHSRCLC
VDRLPPGFSDVDTLRQALSAVHSPTFCQLACGQDGQLKGFAVLEYETAEMAEAAQQRADG
LALGDSHLRVSFCAPGPPGRSMLAALIAAQATALNRGKGLLPEPNILQLLNNLGPSASLQ
LLLNPLLHSSVGGKQGLLGAPPAMPLLSGPALSTALLQLALQAQSHKKPGILGDSPLGPL
QAGPQPANPLLGDLSAGGTLAPELPPRRGKPPPLLPPLLGPSGGDREPMGLGPTAAQLTP
PPAPVGIRGPGLRGLQKDSGPLPTPTGVSLLGEPPKDYRIPLNPYLNLHSLLPATNLAGK
EARGWGCATRGRHQAEGALPNPPAPGGGSGTGGSGSKAFPLKSRLLSPLAGSRLPPEPGL
PDSYGFDYPSDVGPRRLFSHPREPALGPHGPSRHKMSPPPSGFSERSGGGGPLSHFYSGS
PTSYFTSGLQAGLKQSHLNKAVGSSPLGSSEGLLGLSPGPNGHSHLLKTPLGGQKRSFAH
LLPSPEPSPEGSYVGQHSQGLGGHYADSYLKRKRIF
Download sequence
Identical sequences G5B227
HGL_H00000293677 XP_004865546.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]