SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000293995 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000293995
Domain Number 1 Region: 197-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-22
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 155-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 3 Region: 238-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.5e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 1-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-16
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000293995
Sequence length 294
Comment ZNF75A (Homo_sapiens) zinc finger protein 75a
Sequence
MYFSQEEWELLDTTQKALYNDVMQENYENVISVALFGLPKPKVISCLEQGEEPWVQGSLD
FKDSPRESPTEFKLRKDTENHQSVSLSALEIHTPRVIVSKKAKVNVSQQTAGKENHDMHR
VGKWHRDFPVKKRKKFSTWKQELLKLMDLHKKDRKGEKPFKCQECGKSFKVSSDLIKHQR
IHTEEKPYKCPQCDKRFRWSSDLNKHLTTHQGIKPYKCSWCGKSFSQNTNLHTHQRTHTG
EKPFTCHECGKKFSQNSHLIKHRRTHTGEQPYSCGVCKRNFSRRSSLLRHQKIH
Download sequence
Identical sequences G5B1H8
HGL_H00000293995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]