SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000294008 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000294008
Domain Number 1 Region: 617-745
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000863
Family BTB/POZ domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000294008
Sequence length 1761
Comment BTBD12 (Homo_sapiens) BTB (POZ) domain containing 12
Sequence
MDESDDDFKELCASFFQRVKKTGTKEVLGERKTQKSSNSAQIRSISKKTKQSATSKTLQG
TLKKPQSSSHRAKKQGAPKSQESEPLLPVSGEGGVLAPAVNPAVLQDQAQSIQTENAPNG
DSQRSRSYLTTAAVSSPSKPRTAELVLQRMQQFKRADPERLRHASEDCFLEATLEENVPQ
SPQEEMVAGNENGLGPPATDSDAAVALVLQQEFGREGASAHDDNLEEKGLFFCQMCQKNL
SAMNVTRREQHVNRCLDEAEKALGPSTPQIPECPICGKLFVTSKSRISHLKQCAMRMKVG
PQLLLQAVRMQTAPPEASSSPVAPSFSNLVGGWKRKGATTKKEPQKRRKVDKPEVPSEDL
LVAIALSRSEMEQDPAVPALRLESAFSERTRPGAEKKSRKRKPLVPPPQLLVQDSNTTDR
QIEDRVAQLLSEEIELSSTPPLPASRILREKLKEAGWCLQLPEGKENFLWEGSALTGTWA
MECFYTETLVPPIVLQQPTKGLTQEPKLTLVLPVQPEPGVQRPPALHSSFHEGCSPRDPS
LSASQRERQALQDLMDLAEEGLSANPWPCSGGLVSSGGAPGLDLVPSGVPLTGFALPPEE
KPLERDHHSLLSLGLLAADFGAMVNNPHLSDVQFQTDSGEVLYAHKFVLYARCPLLIQYS
VVPPLPASFCFCGEKGEVNNEGFSAVEDGEETQRVLLSNVSTETTCVFLRYLYTADTGLP
SHLAPELGTLAQRFGVSDLVHLCEQVPAVMDLESERQEEKEDENSESRMENFQQLLRSVW
TDEEEEPETLLKYDEDREKVNEADMEEIYEFAATQRKLLQGGRAPHTDEEPDQPGEDSPV
AGPPLANVLGSKQLEKGEQLELLRPGEYKTPVSGENARHSLLLPPRTSSDRAADAKTQQQ
TAPKKAPGPSSCCLSEGSEAGRQDDFLMHSFEVPAYEQVFSSAQEFSELAQITSDHQEQS
GIVREKGMEMACAPTPQPDQSCLPSWLPGGWSPSRSRLHLHHASDSSPSTTQSHNEVSMV
SPRSSPSPALPSKQDSGILTVLKEPGDWKGRGCHSVLEHKNKGVLISPEKSLPIDLTQSI
PDPLSTRSQDPPSHMSRENEIILLLDSDEELELEQTKTKLVSNGPSEERSVLDVSHKSSE
LFSVIDVDADQEHSQSPPRRGGELQVKSVEGQLENQGVVAGTWASWLICDRESSLNEDST
TDASWLVPATPVASRSRDCSSQTQITSLRTRPPGDKMARPSSRATPENTVLEATQKFSVI
TPPMSPMPPGTSSSGRQVHRSPSRSQSRLLKLSSPRVSWPMAGGLPDFTGPVQKLSPNQA
EVSEVVEVGDSEDEPEVASHQVNRSPLLDSDPPIPVDDCWNVEPLSPIPIDHLNLERTGP
LNTSSPSSQAQEPVDSGDCLSPGLLGSTPIRASGMARRASLEQSSGAGSPAASRLSFLNP
ALWDDWNGEGQKSPEAPPAAQTLHSFRAQKSEGPEIPKGANRKKNLPPKVPISPMPRYSI
METPVLKKELDRFGVRPLPKRQMVLKLKEIFHYTHQTLESDSEEEIQSSQGPPEMPCNQT
LPTEAYNPSRVGDCIPLEATESCKTQQYKEPQHQQKQPSQNIPHQSRPQAEKPPPGPDVD
TQLSASQKSMATSVDSSDSSFSSQSSSCEFGATLQSALEDEEDEGAGVSASQAASQAPDM
EEAVRRYIRSKPELFYKVLMYQPLELAELQAELKQNGIRVPMGKLLDTLDALCITFTTAT
ARKEKLKQKGQQRGRKKGERD
Download sequence
Identical sequences G5B1H0
HGL_H00000294008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]