SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000294309 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000294309
Domain Number 1 Region: 432-605,633-701
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000235
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 2 Region: 80-317
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000000243
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000294309
Sequence length 753
Comment TPCN2 (Homo_sapiens) two pore segment channel 2
Sequence
MSEPQAESEPLLGRARGGSDHDCSEGLLASSSVQVDSGAMARQDLCIDQAVVFIEDAIQY
RSIFHRMDARSMCLYRWYYSNLCQRTLSFTIFLILFLAFIETPSSLTRTADVRYRSLPWE
PPCGLMEGVELLCLLVFVADVSVKGYLVGWSQFQRNLWLLAYLTVLVVSLVDWTVSLSLL
CQEPLRMRRLLRPFFLLQNSSMMKKTLKCIRSSLPDMASVGLLLAIHLCLFTTFGMLLFT
VGEKDMEPNRERLAYFRSLPEALTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFTMIG
SLFLMNLLTAIIYNQFRGYLMKSLQTSLFRRRLGTRAAYEVLSSRLGQAGATPEAVGVKP
QNFLQVLQKVQMTNSHKQAIMEKVHSYNDTLLSADEFQKVFDELDKSVIKEHPLKPQYQS
PFLQTAQFLFSHYYFDYLGNIIALGNLVSICVFLVQDADVLPRNRDDFVLGILDCIFILY
YVLELLLKVFALGPWGYLSYPSNVCDGLLTSILLVLEISTLAVYGFPHPRWKPETLGLLS
LWDMTRLVNMLIVFRFLRIIPNMKPMAMVVSTVLGLVQNLRAFGGILVVVYYVFAIVGIS
LFRGTIVAPFGNSSLAPANGSASCGSFEQLEYWANNFDDFAAALVTLWNVMVVNNWQVIL
DAYERYVGPWSKIYFVLWWLVSSVIWVNLFLALLLENFLHRWDPQNHEQPPAGSVEAAYQ
MSEELMFRDILEEPREEELTEKLCRHPHLWLCR
Download sequence
Identical sequences G5BSR8
HGL_H00000294309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]