SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000294725 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000294725
Domain Number 1 Region: 89-233
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-25
Family Voltage-gated potassium channels 0.0027
Further Details:      
 
Domain Number 2 Region: 250-367
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0000335
Family Potassium channel NAD-binding domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000294725
Sequence length 1051
Comment KCNT2 (Homo_sapiens) potassium channel, subfamily T, member 2
Sequence
MNENTFKERLKLFFIKNQRSSLRIRLFNFSLKLLSCLLYIIRVLLENPSQGNEWSHIFWV
NRSLPLWGLQVSVALISLFETLLLGYLSYKNDLHRAIQRTQSAMFNQVLILISTLLCLIF
TCICGIQHLERIGKKLNLFDSLYFCIVTFSTVGFGDVTPETWSSKLFVVAMICVALVVLP
IQFEQLAYLWMERQKSGGNYSRHRAQTEKHVVLCVSSLKIDLLMDFLNEFYAHPRLQDYY
VVILCPTEMDVQVRRVLQIPMWSQRVIYLQGSALKDQDLLRAKMDDAEACFILSSRCEVD
RTSSDHQTILRAWAVKDFAPNCPLYVQILKPENKFHIKFADHVVCEEEFKYAMLALNCIC
PATSTLITLLVHTSRGQCVCLCCREGQQSPEQWQKTYGRCSGNEVYHIVLEESTFFAEYE
GKSFTYASFHAHKKFGVCLIGVRREDNKNILLNPGPRYIMNATDICFYINITKEENSAFK
NQDQQRKSNLPRSFYHGPSRLPVHSIIASMGTVAIDLQDTSCRSASGPTLSLPVEGSKEI
RRPSIAPVLEVADTSSIQTCDLLSDQSEDETAPDEEISSNLEYAKGYPPYSPYIGSSPTF
CHLLQEKVPFCCLRLDKSCQHNYYEDAKAYGFKNKLIIVAAETAGNGLYNFIVPLRAYYR
PKKELNPIVLLLDNPPDMHFLDAICWFPMVYYMVGSIDNLDDLLRCGVTFAANMVVVDKE
STMSAEEDYMADAKTIVNVQTLFRLFSSLSIITELTHPANMRFMQFRAKDCYSLALSKLE
KKERERGSNLAFMFRLPFAAGRVFSISMLDTLLYQSFVKDYMISITRLLLGLDTIPGSGF
LCSMKITEDDLWVRTYARLYQKLCSSTGDVPIGIYRTESQKLTTSESQISISVEEWEDTK
DSKDQGQHRSNHRNSTSSDQSDHPLLRRKSMQWARRLSRKGPKHSGKTAEKITQQRLNLY
RRSERQELAELVKNRMKHLGLSTVGYDEMNDHQSTLSYILINPSPDTRLELNDVVYLIRP
DPLAYLPNSEPSRKNSICNATGQDSREETQL
Download sequence
Identical sequences G5BM68
HGL_H00000294725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]