SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000295095-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000295095-1
Domain Number 1 Region: 56-237
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.00006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000295095-1
Sequence length 241
Comment ARHGAP15 (Homo_sapiens) Rho GTPase activating protein 15
Sequence
MFRLYHSALDTSDKNRVKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHPHTVCECENSTV
SWFVKQCIEVVKKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGA
LKMFFRELPEPLFPYSFFEQFVEAIKKPDNNARIETIKFLVQKLPPPNRDTMKVLFGHFT
KVVARASKNLMSTQSLGIVFGPTLLRAENEAGNMAIHMVYQNQIAELMLSKYNEISGSGE
D
Download sequence
Identical sequences G5AKU6
HGL_H00000295095-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]