SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000295470-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000295470-1
Domain Number 1 Region: 150-260
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.24e-28
Family Canonical RBD 0.00012
Further Details:      
 
Domain Number 2 Region: 59-144
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.22e-24
Family Canonical RBD 0.0000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000295470-1
Sequence length 340
Comment HNRPDL (Homo_sapiens) heterogeneous nuclear ribonucleoprotein D-like
Sequence
PDLFRRHFKSSSIQRSAAAASTPAIRTARPLSPADGSATMEDMNEYSNIEEFAEGSKINA
SKNQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAA
SVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIE
NIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKEVYRQQQQQ
QKGGRGAAGGGRGGTRGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGGDQNYSGYGGYDYT
GYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY
Download sequence
Identical sequences G5ALN7
HGL_H00000295470-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]