SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000295731 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000295731
Domain Number 1 Region: 42-197
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 3.14e-83
Family Hedgehog (development protein), N-terminal signaling domain 0.000000076
Further Details:      
 
Domain Number 2 Region: 202-348
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 9.94e-40
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000295731
Sequence length 410
Comment IHH (Homo_sapiens) Indian hedgehog
Sequence
MSPARLRPRLRFCLLLLLLLVPAARGCGPGRVVGGRRRPPRKLVPLAYKQFSPNVPEKTL
GASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQ
WPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYE
SKAHVHCSVKSEHSAAAKTGGCFPAGAQVRLESGAHMALSAVRPGDRVLAMGEDGTPIFS
DVLIFLDREPNRLRVFQVIETQDPPHRLALTPAHLLFTADNHTEPAAHFRATFASHVQPG
QYVLVAGMPGLQPARVIAVSTHVALGAYAPLTRHGTLVVEGVVASCFAAVADHQLAQMAF
WPLRLFPSLVWGSWTLGEGVHWYPQLLYRLGRLLLEESSFHPLGMSGAGS
Download sequence
Identical sequences G5AKL0
XP_004864619.1.39548 HGL_H00000295731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]