SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000295797-12 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000295797-12
Domain Number 1 Region: 93-158
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0075
Further Details:      
 
Domain Number 2 Region: 214-267
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000231
Family Protein kinases, catalytic subunit 0.0026
Further Details:      
 
Domain Number 3 Region: 5-69
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000363
Family PB1 domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000295797-12
Sequence length 269
Comment PRKCI (Homo_sapiens) protein kinase C, iota
Sequence
MTRSLQNSTPFEGLCDKDRDVWCLGNKQLFTTDWVDEEGDPYPVSPQLALEAALRLYQLK
KDSELLIHASPCIPECPIMACAGEDKSIHQRVGGLWRKLYCANGHTFQSKRFSRCAHCTV
CTDCIGGLGHQVYKCVNCKLLVHKKCHKLVTVECGQPSLPSEPMMPVDQSSVASDAAQII
IPHHLSSHEGLEQVDEESEAVNNRETGKASPSLGLQDFDMLRVIGRGGYGKVLLVQLKNS
DRIYAVKAVKKELVDIDWVQTEKRVLEQA
Download sequence
Identical sequences G5B2B4
HGL_H00000295797-12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]