SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000295797-16 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000295797-16
Domain Number 1 Region: 85-154
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000366
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0098
Further Details:      
 
Domain Number 2 Region: 4-68
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000131
Family PB1 domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000295797-16
Sequence length 220
Comment PRKCI (Homo_sapiens) protein kinase C, iota
Sequence
MTRSLESSIHFEGLCDKDRDVWCLDNKQLFTTHWVEEEGDPYTVSPQLELEEAIRLSELK
KDSELLIHSSPCIPGHPKVPCPEEKPIHHRAAGFWRKLYCVNDHTFQAKRFSMQAHCAVC
TYHVGGLGRQVYKCTNCKLLVHKKCHKLVTIECAQYSLPSEPMVPVDPSSMASDPSHTVI
PHNLSTHEALEQVDEETEAGNTGKSGKASFGLGLEDFDLL
Download sequence
Identical sequences G5B8X7
HGL_H00000295797-16

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]