SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000295797-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000295797-2
Domain Number 1 Region: 207-337
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000196
Family Protein kinases, catalytic subunit 0.0000893
Further Details:      
 
Domain Number 2 Region: 46-105
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000082
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0074
Further Details:      
 
Domain Number 3 Region: 163-202
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000683
Family Protein kinases, catalytic subunit 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000295797-2
Sequence length 365
Comment PRKCI (Homo_sapiens) protein kinase C, iota
Sequence
MYFTGQNSEKLEEQSPCPQCRGEHPKVPCPGGEKSICHRAAGHWRKLYCVNGHTFQAKHF
SRRAHCTVCTDHVGGLGHQVYKCTNCKLSVHKKCHKLVTIECGQHSLPSETMVPVDPSSM
ASDPAHTAIPHNLSTHEALEQADEENEAGNTGEGGKASSGLGLEDFYLLHVIGRGSYGKI
LLVQLKKSDRMYAMKAVKKELFYIHQALGVLMYMMMIGESPFHLDECSDIPFEDSIKNLF
RVILERDIFIPRCLSVQAASILEGFLNRDPKEQLGCHPHRGFGDVQEHPFFQNVDWDMME
QKQVVPPFKPNISEEFSLDNFDPEFTNQPVWLTSGDNDIVRELDGNEFASFEYINHLMMY
EEEGV
Download sequence
Identical sequences G5ALG7
HGL_H00000295797-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]