SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000295797-26 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000295797-26
Domain Number 1 Region: 215-461
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.19e-64
Family Protein kinases, catalytic subunit 0.0000014
Further Details:      
 
Domain Number 2 Region: 95-155
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000244
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 
Domain Number 3 Region: 5-68
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000288
Family PB1 domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000295797-26
Sequence length 462
Comment PRKCI (Homo_sapiens) protein kinase C, iota
Sequence
MTRSLENSIHFEDLCDKDPDVLCLDNKQLFTTPWVEEEGDLYAVSPQLELEEAIRLSELK
KDSKLLIHSSPGIPEHPKVPYPGEEKSIHHKAAGFWRKLYYANGHTFQAKCFSRQAHCAV
CTDRVGALGLQVYKCTNCKLWVHKCHKIATIECGQRSLPSEPIVPVNPSSMASNPAHTVI
PHNFSTHEALEQVDEENEAGNTRESGKASSSLGLEDFDLLPVIGRGSYGKILLIQQKESN
CMYAMKAVKKEHVNIDQIQKEKCILEQAFNCPFLVGLNACFQTESRLVLVLDYVNGGDLL
FHVQQHRWLPEKHARFYSTEISLAVNYLHQQGILYRILKLENILLDSEGHIKLINFCLCK
EGLQPGDTTHTFCGTPNFMAPELIRREDYSFSVDWWNLGVVIYIMMIGESPFHLDESSDN
PYENSIKHFLQIILERDTVISRFLSVQAASVLEGFLNKDPKE
Download sequence
Identical sequences G5BGU3
HGL_H00000295797-26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]