SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000295797-38 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000295797-38
Domain Number 1 Region: 240-489
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-46
Family Protein kinases, catalytic subunit 0.00000305
Further Details:      
 
Domain Number 2 Region: 12-95
Classification Level Classification E-value
Superfamily CAD & PB1 domains 5.49e-24
Family PB1 domain 0.00000719
Further Details:      
 
Domain Number 3 Region: 111-181
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.11e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000295797-38
Sequence length 507
Comment PRKCI (Homo_sapiens) protein kinase C, iota
Sequence
MRNSWQSQNVSLNVTLKGLMHRDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWID
EEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGEDKSIYRRGARRW
RKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIECGR
HSLPPEPMMPMDQSSMHSDHAQTVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQ
DFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNH
PFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHASVDWWALGVLMFEMMAG
RSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHP
QTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPDDDD
IVRKIDQSEFEGFEYINPLLMSAEECV
Download sequence
Identical sequences G5BT66
HGL_H00000295797-38

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]