SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000295797-42 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000295797-42
Domain Number 1 Region: 243-306
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000404
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0096
Further Details:      
 
Domain Number 2 Region: 146-219
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000942
Family PB1 domain 0.00017
Further Details:      
 
Weak hits

Sequence:  HGL_H00000295797-42
Domain Number - Region: 365-393
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0129
Family Protein kinases, catalytic subunit 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000295797-42
Sequence length 423
Comment PRKCI (Homo_sapiens) protein kinase C, iota
Sequence
MVSLGVTTSDLPKSRYPSEDSLSPNINGRETGKSTGQVSPGPETPSSSGQVXXXXXXXXX
XXXXXXXXXRDTLRSLVYIHPGLTATIGNNFTKSLAEFRLVWSLQAVRLLSLSEPCLPAS
LGRQPIYGPFFPGTSTTYTSTRSALILGRDIMARSLENSIPFEGLCDEDGDVLCLDNKQL
FFTTWVEEEGDLYTVSPQLELEEAIRLSELKKDSELSIHSSPCIPEHPKLPYPGGEKSIH
HRAAGCWRKVYYVNGHTFQAKRFSRRAHCAICTDCVGGLGHQVYKCTKCKLSIHKKCHKL
VTIECRQRSLPPDPMVPVDPSSMASDPAHTAIPHNLSTHEALEQVDEEHEAGNTGEGGKA
SSGLGLQDFDLIPVIGRGSYGKVLLIQQKESNYNNDVMRELDGYEFASFEYISHLTMYEE
EGV
Download sequence
Identical sequences HGL_H00000295797-42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]