SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000295797-44 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000295797-44
Domain Number 1 Region: 216-529
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.93e-77
Family Protein kinases, catalytic subunit 0.000000121
Further Details:      
 
Domain Number 2 Region: 93-157
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000114
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 
Weak hits

Sequence:  HGL_H00000295797-44
Domain Number - Region: 14-70
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000186
Family PB1 domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000295797-44
Sequence length 555
Comment PRKCI (Homo_sapiens) protein kinase C, iota
Sequence
MTTRSLENLIFSKGLCDKDRDVWHLGNEQLCTTRWVEEEGDPHTASPQLELKEAIRLSEL
KKDSELLIHASPCISEHPKVPCPGGEKSIHHRSAGCWRKLYYANGHAFQAKCFSRGARCA
VCTDLAGGLGCRVYKCTDCKLLVHKKCHKLLTVECGQRSSPSETMMPVDPSSVASDPAKT
AIPRNLSTYEALEQVDKENAAGNTGEGGKASSGLGLEDFDLLRVIGRGSFAKVLLVQLKK
SDCKYAMKVVKKEHVSPDRVWAEKHVLEQAANYPFLVGLHSCFQTESRLFFILDYVNGGD
LLFHMQQQRILPEEHARFYSAEICLAFSYLHQRGIMYRNLKFDNLLLDSEGHIKLTDYCL
CKAGLQPGGTTRTFCGIPNYLAPEVVRGEDYGFGVDWWNLGVVMYEMMIGKSPFHFDESL
VNPYENSMDYLLKVILESNIYIPPCLSVHAASVLERFLDRDPKRRLGCHTQKGFVDVQEH
AFFQNVDWDMMEQKQVVPPFKPNVSEEFGLDNFDPEFTNEPVRLTPDDNDIVKKIDGYEF
EGFEYINHLSMYEEE
Download sequence
Identical sequences G5C0M5
HGL_H00000295797-44

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]