SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000295797-45 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000295797-45
Domain Number 1 Region: 215-281
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000192
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.009
Further Details:      
 
Domain Number 2 Region: 8-70
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000314
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0099
Further Details:      
 
Domain Number 3 Region: 337-403
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000356
Family Protein kinases, catalytic subunit 0.004
Further Details:      
 
Domain Number 4 Region: 128-183
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000535
Family Protein kinases, catalytic subunit 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000295797-45
Sequence length 447
Comment PRKCI (Homo_sapiens) protein kinase C, iota
Sequence
MHHRAAGCWEKLYYPNGHTFQAKRFSRQAHCAVYTDCVGGLGHQVYKCTNCKPSVHKKCH
KLVTIECGQHSLSSEPMVPVDPSSMTSDPAHTVITHNLSTHEALEQDDEENEAGNTGESG
KASSGLGLEDFDLLQVIGRESYGKVLLVQLKELNPMYAIKAVKKEHFDIHQLELEETIRL
SELKKDSELLIHSLPCIPEHPKVPCPGEEKSMHHRAAGCWEKLYYPNGHTFQAKRFSRQA
HCAVYTDCVGGLGHQVYKCTNCKPSVHKKCHKLVTTECGQHSLSSEPMVPVDPSSMTSDP
AHTVITHNLSTHEALEQDDEENEAGNTGESGKASSGLGLEDFDLLQVIGRESYGKVLLVQ
LKELNPMYAIKAVKKEHFDIHQVKHVVMKTSAISISHLHDHLNHACDIQARGYSLQEHSS
ILATQINGTALRPATGKHKAGRATADP
Download sequence
Identical sequences G5C3T2
HGL_H00000295797-45

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]