SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000295888 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000295888
Domain Number 1 Region: 2690-2978
Classification Level Classification E-value
Superfamily BEACH domain 7.19e-126
Family BEACH domain 0.0000000169
Further Details:      
 
Domain Number 2 Region: 3086-3265,3398-3443
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.52e-31
Family WD40-repeat 0.0015
Further Details:      
 
Domain Number 3 Region: 2536-2658
Classification Level Classification E-value
Superfamily PH domain-like 2.7e-22
Family PreBEACH PH-like domain 0.017
Further Details:      
 
Domain Number 4 Region: 3451-3519
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Domain Number 5 Region: 1180-1286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000317
Family Trypanosoma sialidase, C-terminal domain 0.078
Further Details:      
 
Domain Number 6 Region: 470-514,580-658,852-919
Classification Level Classification E-value
Superfamily ARM repeat 0.000000608
Family Armadillo repeat 0.068
Further Details:      
 
Weak hits

Sequence:  HGL_H00000295888
Domain Number - Region: 1410-1461,1513-1579,1613-1704
Classification Level Classification E-value
Superfamily ARM repeat 0.000155
Family HspBP1 domain 0.043
Further Details:      
 
Domain Number - Region: 2346-2423
Classification Level Classification E-value
Superfamily Cyclin-like 0.000612
Family Retinoblastoma tumor suppressor domains 0.012
Further Details:      
 
Domain Number - Region: 117-392
Classification Level Classification E-value
Superfamily ARM repeat 0.0201
Family Armadillo repeat 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000295888
Sequence length 3528
Comment WDFY3 (Homo_sapiens) WD repeat and FYVE domain containing 3
Sequence
MNMVKRIMGRPRQEECSPQDNALGLMHLRRLFTELCHPPRHMTQKEQEEKLYMMLPVFNR
VFGNAPPNTMTEKFSDLLQFTTQVSRLMVTEIRRRASNKSTEAASRAIVQFLEINQSEEA
SRGWMLLTTINLLASSGQKTVDCMTTMSVPSTLVKCLYLFFDLPHVPEAVGGAQNELPLA
ERRGLLQKVFVQILVKLCSFVSPAEELAQKDDLQLLFSAITSWCPPYNLPWRKSAGEVLM
TISRHGLSVNVVKYIHEKECLSTCVQNMQQSDDLSPLETVEMFARLSCFLKDSSDVSQTL
LDDFRIWQGYNFLCDLLLRLEQAKEAESKDALKDLVNLITSLTTYGIHELKPAGITTGAP
FLLPGFAVPQPAGKGHSVRNIQAFAVLQNAFLKAKTSFLAQIILDAITNIYMADNANYFI
LESQHTLSQFAEKISKLPEVQNKYFEMLEFVVFSLNYIPCKELISVSILLKSSSSYHCSI
VAMRTLLKFTRHDYIFKDVFREVGLLEVMVNLLHKYAALLKDPTQALHEQGDSRNNSSVE
DQKHLALLVMETLTVLLQGSNTNAGIFREFGGARCAHNIVRYPQCRQHALMTIQQLVLSP
NGDDDMGTLLGLMHSAPPTELQLKTDILRALLSVLRESHRSRTVFRKVGGFVYITSLLVA
MERSLSCPPKSGWEKVNQNQVFELLHTVFCTLTAAMRYEPANSHFFKTEIQYEKLADAVR
FLGCFSDLRKISAMNVFPSNTQPFQRLLEEEAISMDSVSPTLRHCSKLFIYLYKVATDSF
DSRAEQIPPCLTSESSLPSPWGTPALSRKRHAYHSVSTPPVYPAKNVADLKVHMTPSSLQ
SSDAVIIHPGAMLAMLDLLASVGSMTQPEHALDLQLEVANILQSLVHTERNQQVMCEAGL
HARLLQRCSTALADEDHALHPPLQRMFERLASQALEPMVLREFLRLASPLNCGAWDKKLL
KQYRVHKPSSLSYEPEMRSSMLTSLEGLGSDNVFSLHEDNHYRISKSLVKSAEGSTVPLT
RVKCLVSMTTPHDIRLHGSSVTPAFVEFDTSLEGFGCLFLPSLAPHNAPTNNAVTTGLTD
GAVVSGIGSGERFFPPPSGLSYSSWFCVEHFSCAPQHHPVRLLTMVRRANSSQQHYVCLA
MVLSAKDRSLIVSTKEELLQNYVDDFSEESSFYEILPCCARFRCGELIVEGQWHHLVLVM
SKGMLKNSTAALYIDGQLVSTVKLHYVHSTPGGSGSANPPVVSTVYAYIGTPPAQRQIAS
LVWRLGPTHFLEEVLPPSSVTTIYELGPNYVGSFQAVCMPCKDAKSEGVVPSPVSLVPEE
KVSFGLYALSVSSLTVARIRKVYNKLDSKAIAKQLGISSHENATPVKLVHNSAGHLNGPA
RTIGATLIGYLGVRTFVPKPVATTLQYIGGAAAILGLVAMASDVEGLYAAVKALVCVVRS
NPLASKEMERIRGYQLLAMLLKKKRPLLNSHILHLTFSLVGTVDSGHETSIIPNSTAFQD
LLCDFEVWLHAPYELHLSLFEHFIELLTESSEASKNAKLMREFQLIPKLLLTLRDMSLSQ
PTIAAISNVLSFLLQGFPNSNDLLRFGQFISSTLPTFAVCEKFVVMEINSEEKFDSGTEE
EFGGLVSANLILLRNRLLDILLKLVYTSKEKTSINLQACEELVRTLGFDWIMMFMEEHLH
STTVTAAMRILVVLLSNQSILIKFKEGLSGGGWLEQTDSVLTNKIGTVLGFNVGRSGAGG
RSTVREINRDACHFPGFPVLQSFLPKHTNVPALYFLLMALFLQQPVSELPENPQVSVPVA
SSRCKQGGQFDLDSIWTFIFGVPASSGTVVSSIHNVCTEAAFLLLGMLRSMLNSPWQSEE
EGSWLREYPVTLMQFFRYLYHNVPDLASMWMSPDFLCALAATVFPFNIRPYSEMVTDLDD
EVGSPAEEFKAFAADTGMNRSQSEYCNVGTKTYLTNHPAKKFVFDFMRVLIIDNLCLTPA
SKQTPLIDLLLEASPERSTRTQQKEFQTYILDGVMDHLLAADVLLGEDASLPITSGGSYQ
VLVNNVFYFTQRVVDKLWQGMFNKESKLLIDFIIQLIAQSKRRSQGLSLDAVYHCLNRTI
LYQFSRAHKTVPQQVALLDSLRVLTVNRNLILGPGNHDQEFISCLAHCLINLHAGSNVEG
FGLEAEARMTTWHIMIPSDIEPDGSYSQDISEGRQLLVKAVNRVWTELIHSKKQVLEELF
KVTLPVNERGHVDIAIARPLIEEAGLKCWQNHLAHEKKSISRGEALVPTTQSKLSRVSSG
FGLSKLTGSRRNRKESGLNKHSLSTQEISQWMFTHIAVVRDLVDTQYKEYQERQQNALKY
VTEEWCQIECELLRERGLWGPPIGSHLDKWMLEMTEGPCRMRKKMVRNDMFYNHYPYVPE
TEQETNMASEIPSKQPEAPDDIIPQKKPARYRRAISYDSKEYYMRLASGNPAIVQDTIVE
SSEGEAAQQEPEHGEDTIAKVKGLVKPPLKRSRSAPDGGDEENQEQLQDQIAESSAIEEE
EKTDNATLLRLLEEGEKIQHMYRCARVQGLDTSEGLLLFGKEHFYVIDGFTMTATREIRD
IETLPLNMHEPIIPRGARQGPSQLKRTCSLFAYEDIKEVHKRRYLLQPIAVEVFSGDGRN
YLLAFQKGIRNKVYQRFLAVVPSLTDSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRW
ERGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYDSEEVDLTNSKTFRNLAKPMGA
QTDERLAQYKKRYKDWEDPNGETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHF
DLADRMFHSVREAWYSASKHNMADVKELIPEFFYLPEFLFNSNNFDLGCKQNGTKLGDVI
LPPWAKGDPREFIRVHREALECDYVSAHLHEWIDLIFGYKQQGPAAVDAVNVFHHLFYEG
QVDIYNINDPLKETATIGFINNFGQIPKQLFKKPHPPKRVRSRLNGDNAGISVPLGSTSD
KIFFHHLDNLRPSLTPVKELKEPVGQIVCTDKGILAVEQNKVLIPPTWNKTFAWGYADLS
CRLGTYESDKAVTVYECLSEWGQILCAICPNTKLVITGGTSTAVCVWEMGTSKEKAKSLV
LKQALLGHTDTVTCATASLAYHIIVSGSRDRTCIIWDLNKLSFLTQLRGHRAPVSALCIN
ELTGDIVSCAGTYIHVWSINGNPIVSVNTFTGRSQQIMCCCVSEMNEWDTQNVIVTGHSD
GVVRFWRMEFLQVPETPAPEPVEVLEMQEECPEAQIGQEAQDEDSSDSEAEEPSISQEPR
DVPSQPSSTSHRPRAASCRATATWCTDSSSDDSRRWSDQLSLDEKDGFIFVNYSEGQARA
HLQGPLNHPQPNPMEARSYSRLKPGYRWERQLVFRSKLTMHTAFDRKDNAHPAEVTALGV
SKDHSKILVGDSQGRVFSWSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRN
CGQLFCQKCSRFQSEIKRLKISSPVRVCQNCYYNLQHERGSEDGPRNC
Download sequence
Identical sequences G5AT03
HGL_H00000295888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]