SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000296137 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000296137
Domain Number 1 Region: 52-206
Classification Level Classification E-value
Superfamily RUN domain-like 1.27e-36
Family RUN domain 0.00056
Further Details:      
 
Domain Number 2 Region: 1400-1514
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 3.27e-29
Family Supernatant protein factor (SPF), C-terminal domain 0.0011
Further Details:      
 
Domain Number 3 Region: 1136-1199
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.28e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0012
Further Details:      
 
Weak hits

Sequence:  HGL_H00000296137
Domain Number - Region: 256-415
Classification Level Classification E-value
Superfamily Tropomyosin 0.0477
Family Tropomyosin 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000296137
Sequence length 1516
Comment FYCO1 (Homo_sapiens) FYVE and coiled-coil domain containing 1
Sequence
MAASSAEGQLQRIIRDLQGQQFGNSHHRSGFRVRGSRCSRCGTSVASLVVAGDAVTELSN
EFKEAGEPITDDSPSLHKFSYKLEYLLQFDLKEKASLLGTRKDYWDYLCACLAKVKGASD
GIRFVKSISELRTSLGKGRAFIRYSLVHQRLADTLQQCFMNTKVTSDWYYARSPFLKLKL
SSDIVGQLYELTEVQFDLASRGHDLDAAWPTFARRTLAPGSPAYLWKAPSRSSSMSSLVS
SYLQTQEMASNFDLSSPLNNEALEGFDEMRLELDQLEVREKQLQERVQQLEQEKQELQAA
LSTQQEQLQVEKQRGHAATEDHRHLVGLLAELQKQWEVTQATQDTIKELQMCLQALERDT
AKEEDSSTLQHLGAMLQPLARELKAAWDSLGEKNQLLSSLSDSLARAEQRADTALDTKGQ
QGPIPADSALKLQELGAKLQSLEAENSKVQEFNRQQSAQLATELQLKEEARAGLEHQVQE
VAQLRKELSRKEQEAAQLQQQLQESLARSSSLEEQLAGLRREEQLQQEEKEMLAQEARSL
SRQLQVLETQLAQVSQHVGDLEEQKKQLIQDKDRLSQKVGALEQLAEQAAPEPSVASEWG
EAPASPVSTLQQAGEKPAEGQRDSTEVQEPKQEEEDLRQANWELQRELQSMAGRNQLLEG
KLQALQADYQALQQREAAIRGSLASLEAEQASIRHLGDQMEASLLAVQKAKQTMKAQVAK
KEAALQSKEDECRQLREEVAQCRQVAESRDKDLRVLSEECHHQAQLIDALKAEKGQQGLG
PPQDGTTQLALAQAQLEVHQGEAERLRAELVEMQAKLWAALGDQDKELLQEGRASAAQQR
RQELRALQEELAQATRSSEEARLEHAELQEQLHRANTDTAELGIQVCTLTAEKERVEGEL
RICREAASQEREGLERQVAGLLQEKASLQEKLTAAENAAGSLASLQAQLAQAEQRAQSLE
EAKHQEHDALKFQLSAEIMDHQSRLKAATEECRSLRAQLEQQGQQLRATEEAVGKLKATQ
ADMGEKLSCTSSRLSECQAAVVQKDKEGSALRESLERTQKELEIATTRSQEYCNRLRQEV
SERERSDQKMLADLDDLHRTKKYLEERLIELLRDKDALWQKSDALEFQQKLSSEERWLGD
AEASHCLDCKREFSWMVRRHHCRVCGHVFCYYCCNNYVLTKPSGRKERCCRACFRKFSEG
PGSPNSSGSATSQGEPSPRLSPAHAGPQAVGSQGADCRQPDDAVFDIITDEELCQIQESG
SSLPATPTETDSLDPSMAEQCTGEEFDPELHIKQGPGSAETGAPTPCCPGGDGAWRSCCF
PNADPESPRRGTQLTCASVAHTHGPVRFLNGTRDTTSNSLTPEDTEDMPVGQDAEICLLK
SGELMIKVPLTVDEIASFGEGSRELFVRSSTYSLIPITVAEPGLTISWVFSSDPKSISFS
VVFREAEDAPLDQCKVLIPTTRCHSHKESIQGQLKVRAPGIYMLIFDNTFSRFISKKVFY
HLTVDRPVIYDGSDFP
Download sequence
Identical sequences G5ANN7
HGL_H00000296137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]