SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000296266 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000296266
Domain Number 1 Region: 13-86,116-223,278-377
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.97e-44
Family WD40-repeat 0.0023
Further Details:      
 
Domain Number 2 Region: 536-601
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000353
Family WD40-repeat 0.015
Further Details:      
 
Weak hits

Sequence:  HGL_H00000296266
Domain Number - Region: 719-863
Classification Level Classification E-value
Superfamily TPR-like 0.0224
Family Tetratricopeptide repeat (TPR) 0.05
Further Details:      
 
Domain Number - Region: 838-1004
Classification Level Classification E-value
Superfamily ARM repeat 0.0426
Family Clathrin heavy-chain linker domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000296266
Sequence length 1268
Comment IFT122 (Homo_sapiens) intraflagellar transport 122 homolog (Chlamydomonas)
Sequence
MRAVLTWRDKAEQCIYDLAFKPDGTQLILAAGNRLLVYDTSDGTLLQPLKGHKDTVYCVA
YAKDGKRFASGSADKSVIIWTSKLEGILKYTDLSCIPGFSSLCIFTAACETPVPACDDLQ
LFSPRHNDSIQCVSYNPVTHQLASCSSGDFGLWSPEQKSVTKHKSSSKITCCSWTNDGQY
LALGMMNGVISIRNKNGEEKVKIERTGGSLSPIWSICWNPSSRWENLWMNRDSENADSRY
FQELSSTLKGAVYSSQGSEAEEEEPAEEDNNLEEHNDILAIADWGQKLSFYQLSGKQVGK
DRPLNFDPCCISYFSKGEYILLGGSDRQVSLFTKDGVRLGTVGEQSSWVWTCREKPDSNY
VVTGCQDGTIAFYQLVFSTVHGLYKDRYAYRDSMTDVIVQHLITEQKVRIKCKELVKKIA
IYKNRLAIQLPEKILIYELYSDDSSDMRYRLKEKILKKFECNLLVVCASHIILCQEKRLQ
CLSFSGGKEREWQMESLIRYIKVIGGPPGREGLLVGLKNGQVSASLVPSXDNLFAIVLLK
HPTAVRCLDMSASRKKLAVVDENDTCLVYDIHTKELLFQEPNANSVAWNMQCEDMLCFSG
ASYLSIKASTFPVHQQKLQGYVVGYNGSKIFCLHDFAMSAVEVPQSTPMYQYLDRKMFRE
AYQIACLGVTDADWRELAMEALEGLEFETAKKAFARVQDLRYLELISSIEERKKRGETNS
DLFLADVFAYQGKFHEAAKLYKRSGHEDFALAMYTDLCMFEYAKDFLRSGDPKETKMLIT
KQADWARNINEPKAAVEMYLSAGEYTKAIKISGNLGWVDMLIDITRKLDKAEREPLLLCA
HYFKELDSPSYAAETYLKLGDLKALVRLHVDTQHWDEAFTLGEKHPEFKDDIYVPYAQWL
AENDRFEEAQKAFHKAGWQGEAVRVLEQLMHNAVAENRFSDAAYYYWMLSMQCLEIAQDP
AQKDAMLDKFHHFQHLAKLYHGYHAIQRFTEEPFSLYRPETLFNISRFLLHSLTKDMPPG
ISKVNILYTLAKQSRALGAYKLARHAYNKLQGLVVPDKFQQSIELGSLTIRSKPFHDSEE
LVPLCYRCSTNNPLFNSLGNVCVNCRQPFVFSASSYEVLHLVEFQLEEGISDEEAVALID
LEAPQHQQEDRWQEVASNFQTLRLDETVDPTGDDDPFTAKLSFEQGSSEFVPVVVGRAVL
RSMSRRDVLIKRWPLPLRWQYFRSLLPDIAITMCPSCFQMFYSEDYELLVLQHSCCPYCR
RRINNPGP
Download sequence
Identical sequences G5BYE2
HGL_H00000296266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]