SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000296440 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000296440
Domain Number 1 Region: 28-479
Classification Level Classification E-value
Superfamily Sema domain 4.32e-113
Family Sema domain 0.00021
Further Details:      
 
Domain Number 2 Region: 1601-1722,1910-2096
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-39
Family p120GAP domain-like 0.018
Further Details:      
 
Domain Number 3 Region: 1067-1162
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000271
Family Other IPT/TIG domains 0.0058
Further Details:      
 
Domain Number 4 Region: 1159-1250
Classification Level Classification E-value
Superfamily E set domains 0.000000000000299
Family Other IPT/TIG domains 0.044
Further Details:      
 
Domain Number 5 Region: 482-531
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000124
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 1249-1293,1323-1376
Classification Level Classification E-value
Superfamily E set domains 0.0000000000437
Family Other IPT/TIG domains 0.067
Further Details:      
 
Weak hits

Sequence:  HGL_H00000296440
Domain Number - Region: 638-673
Classification Level Classification E-value
Superfamily Plexin repeat 0.00379
Family Plexin repeat 0.0084
Further Details:      
 
Domain Number - Region: 1026-1068
Classification Level Classification E-value
Superfamily Plexin repeat 0.0127
Family Plexin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000296440
Sequence length 2129
Comment PLXNB1 (Homo_sapiens) plexin B1
Sequence
MPALGSALLQALWAGLVLALQPPPPAAFTPNGTHLQHLARDPTSGTLYLGATNFLFQLSP
ELHLEAMVSTGPVLDSRDCLPPVMPDECPQAQLTNNPNQLLLVSPGALVVCGSVHQGVCE
QRRLGQLGQLLLQPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALRPPDPQAAFSYEETAKLAVGHLSEYSHHFVSAFVRGASAYFLFLRRDLKAP
SRAFRAYVSRVCLWDQHYYSYVELPLACQGGRYGLIQAAAVATSGEVAGGEVLFAAFSSA
APPTVGQPPSAATGASRASALCAFPLDEVDRLANHTRDACYTRKGLAEDKTEVAYIAYHV
SSSCDQLPMDTPDAFPCGSDHTPSPMASRVPLEATPVLEWPGVQLTAVAVTMEDGHTIAF
LGDSQGQLHRVYLGSGSDGRSYSTQSIQWGSAVSRDLTFDGTFEHLYVMTQTTLVKVPVA
SCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQHPEKWLWSFQPEPGCLQVAAMS
PANISREEKQEVFLLVPDLPPLWPGESYSCHFGEHQSPALLTSSGVMCPSPDPSEVPVLQ
RGADHMSVSVELRFGTVVIVRASLSIYDCVAVTELHPSAPCQACVSSRWGCNWCVWQHLC
THKAACDAGPMVVSQQSPLFSLAPPARDMPSPLPPTTPQTMVTPTSYTVPLEPGAPSITP
ASDVSPGVRPSLLSPWRPWAGPGPIPSPTSTESPLHEKPLLPSFPTRPGNSVPAPTDLGP
SAVPEDLSTSHLAPSEAAAMPPAEPDPEALSSTVALDQPPGTAPATTFPGAAGSTKPALD
WLMREGGELPEADEWTGGDAPAFSTSTLLSGDGDSAEHEGPLAPLILLSSLDYQYDTPGL
WELGEASWRAGSCPCVESVQSSTLIPVSVEREVHLRGQNLRLLQDSPGDSECVMQLEGHE
VVVKAQVECESPPNTWCHVKCQQHQLSYEALQPELRVELFLRWAGRLRVDSADGLHVVLY
DCSVGHGDCSHCQTAMPQYGCVWCEREHPRCVAKEACGKSEAVATQCPAPLISSVEPLTG
PVDGGTRVTIRGSNLGQHVHDVLDMVRVAGVPCAVDAQDYEVSSSLVCITGASGEEVTGA
VVVEVLGRGRGISELNFAYQDPKVHSIFPVQGPRAGGTCLTLHGSKLLTGRLEDIRVVVG
DQPCRLLLEPQLEQLRCETSPYHMPTTLPVMVWFGATERRLQHGQFKYTADPNVTSAGPT
KSFLSGGREIWVRGQNLDVVQMPRIRVTVASGPLQPGQGLGRRRRVVPEAACSPGASCGG
QHFEEPCNVNSSQLILCRTPALPGLPEDLLVQVEFILDNLVFDFATLSPTPFSYEADPTL
KPLNPEDPTAPFRHKPGSVFSVEGDNLDLAISKEEVVAMIGDGPCVVKTLTRYHLYCEPP
MEQPLPWHHTLREAPDTLPEFTVQMGNLHFSLGHVKYDGESPVAFPVAAQVGLGVGTSLL
ALGVIIIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDLLG
SGIPFLDYKVYAERVFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFI
HTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPKLMLRRTE
TVVEKLLTNWMSICLYTFLRVGKGGRGRQSSLDKGPVDSVTGKAKYTLNDNRLLREDVEY
RPLTLNVLLAMGPGTGESQGMPVKVLDCDTISQAKEKMLDQLYKGVPLAQRPDPHTLDVE
WRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRENQDYVP
GERTPMLEDVDEGGIRPWHLVKPSEEPEPPRPRRGSLRGGERERAKAIPEIYLTRLLSMK
GTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFW
INIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRDSPINKLLYARDIPHYK
GMVERYYADIRQTVPASDQEMNSALAELSRNYSGDLGARVALHELYKYINKYYDQIITAL
EEDGTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences G5AVM5
HGL_H00000296440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]